Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:46
 aligned with ZKSC5_HUMAN | Q9Y2L8 from UniProtKB/Swiss-Prot  Length:839

    Alignment length:89
                                   532       542       552       562       572       582       592       602         
          ZKSC5_HUMAN   523 GQPSSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQHQRVHTGEKPYTCPLCG 611
               SCOP domains ---------------------d2emma1 A:8-35              ---------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....--------------.......ee......ee.hhhhhhhhhhhhh....-----------------------..------.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------ZINC_FINGER_C2H2_1   -------ZINC_FINGER_C2H2_1   -------ZINC_ PROSITE
               Transcript 1 Exon 1.9c  PDB: A:1-46 (gaps) UniProt: 460-839 [INCOMPLETE]                               Transcript 1
                 2EMM A   1 GSSGS--------------SGTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKP-----------------------SG------PSSG  46
                                |    -         6        16        26        36   |     -         -       ||-     |   
                                5              6                                40                      41|     43   
                                                                                                         42
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'