Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:89
 aligned with COT1_HUMAN | P10589 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:105
                                    74        84        94       104       114       124       134       144       154       164     
           COT1_HUMAN    65 GTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPG 169
               SCOP domains d2ebla_             A: automated matches                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......------------............ee..ee.hhhhhhhhhhhhh.......................hhhhhhhhhhhh.hhhhhh..----...... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------KR-P------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------------NUCLEAR_REC_DBD_2  PDB: A:8-82 UniProt: 83-158                              ----------- PROSITE (1)
                PROSITE (2) ---------------------NUCLEAR_REC_DBD_1          --------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: A:1-79 (gaps) UniProt: 1-155 [INCOMPLETE]                                   -------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.4c       Transcript 1 (2)
                 2EBL A   1 GSSGSSG------------IECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRG----SGPSSG  89
                                  |  -         8        18        28        38        48        58        68        78    |   84     
                                  7            8                                                                         83   84
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'