Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:200
 aligned with Q8ISI9_9ALVE | Q8ISI9 from UniProtKB/TrEMBL  Length:280

    Alignment length:200
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
         Q8ISI9_9ALVE    76 PSSGLRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATGLPESRINLKSLVTLGPDRAGENVFNAAGQIYNHNMYWLSMVPTSGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTRERRLDLVGTKDAHSPLSEDAGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL 275
               SCOP domains d2cw3a1 A:4-90 automated matches                                                       d2cw3a2 A:91-203 automated matches                                                                                SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee...hhhhhh..eeeeeeee.hhhhhhhhhh.hhhhhhhhhhh..hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2CW3 A   4 PSSGLRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATGLPESRINLKSLVTLGPDRAGENVFNAAGQIYNHNMYWLSMVPTSGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTRERRLDLVGTKDAHSPLSEDAGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL 203
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203

Chain B from PDB  Type:PROTEIN  Length:196
 aligned with Q8ISI9_9ALVE | Q8ISI9 from UniProtKB/TrEMBL  Length:280

    Alignment length:196
                                    89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269      
         Q8ISI9_9ALVE    80 LRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATGLPESRINLKSLVTLGPDRAGENVFNAAGQIYNHNMYWLSMVPTSGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTRERRLDLVGTKDAHSPLSEDAGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL 275
               SCOP domains d2cw3b1 B:8-90 automated matches                                                   d2cw3b2 B:91-203 automated matches                                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee...hhhhhh..eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2CW3 B   8 LRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATGLPESRINLKSLVTLGPDRAGENVFNAAGQIYNHNMYWLSMVPTSGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTRERRLDLVGTKDAHSPLSEDAGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL 203
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'