Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:62
 aligned with Q8TZN2_PYRFU | Q8TZN2 from UniProtKB/TrEMBL  Length:71

    Alignment length:66
                                    14        24        34        44        54        64      
          Q8TZN2_PYRFU    5 SLLEKVLKEWKGHKVAVSVGGDHSFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL 70
               SCOP domains d1ycya1 A:5-70 Hypot    hetical protein PF1955                     SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhh..eeeeee.----.eeeeeee...eeeeeeeee..eeeeeeeeee...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1YCY A  5 SLLEKVLKEWKGHKVAVSVG----FTGTLEDFDEEVILLKDVVDVIGNRGKQmLIGLEDINWImLL 70
                                    14        24    |   34        44        54  |     64   |  
                                              24   29                          57-MSE     68-MSE

Chain B from PDB  Type:PROTEIN  Length:62
 aligned with Q8TZN2_PYRFU | Q8TZN2 from UniProtKB/TrEMBL  Length:71

    Alignment length:66
                                    14        24        34        44        54        64      
          Q8TZN2_PYRFU    5 SLLEKVLKEWKGHKVAVSVGGDHSFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL 70
               SCOP domains d1ycyb_ B: automated     matches                                   SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhh..eeeeee.----.eeeeeee...eeeeeeee....eeeeeeeee...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1YCY B  5 SLLEKVLKEWKGHKVAVSVG----FTGTLEDFDEEVILLKDVVDVIGNRGKQmLIGLEDINWImLL 70
                                    14        24    |   34        44        54  |     64   |  
                                              24   29                          57-MSE     68-MSE

Chain C from PDB  Type:PROTEIN  Length:62
 aligned with Q8TZN2_PYRFU | Q8TZN2 from UniProtKB/TrEMBL  Length:71

    Alignment length:66
                                    14        24        34        44        54        64      
          Q8TZN2_PYRFU    5 SLLEKVLKEWKGHKVAVSVGGDHSFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL 70
               SCOP domains d1ycyc_ C: automated     matches                                   SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhh..eeeeee.----.eeeeeee...eeeeeeee....eeeeeeeee...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1YCY C  5 SLLEKVLKEWKGHKVAVSVG----FTGTLEDFDEEVILLKDVVDVIGNRGKQmLIGLEDINWImLL 70
                                    14        24    |   34        44        54  |     64   |  
                                              24   29                          57-MSE     68-MSE

Chain D from PDB  Type:PROTEIN  Length:62
 aligned with Q8TZN2_PYRFU | Q8TZN2 from UniProtKB/TrEMBL  Length:71

    Alignment length:66
                                    14        24        34        44        54        64      
          Q8TZN2_PYRFU    5 SLLEKVLKEWKGHKVAVSVGGDHSFTGTLEDFDEEVILLKDVVDVIGNRGKQMLIGLEDINWIMLL 70
               SCOP domains d1ycyd_ D: automated     matches                                   SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
           Pfam domains (1) DUF3202-1ycyD01 D:5-    70                                         Pfam domains (1)
           Pfam domains (2) DUF3202-1ycyD02 D:5-    70                                         Pfam domains (2)
           Pfam domains (3) DUF3202-1ycyD03 D:5-    70                                         Pfam domains (3)
           Pfam domains (4) DUF3202-1ycyD04 D:5-    70                                         Pfam domains (4)
         Sec.struct. author hhhhhhhhhhh..eeeeee.----.eeeeeee...eeeeeeee....eeeeeeeee...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1YCY D  5 SLLEKVLKEWKGHKVAVSVG----FTGTLEDFDEEVILLKDVVDVIGNRGKQmLIGLEDINWImLL 70
                                    14        24    |   34        44        54  |     64   |  
                                              24   29                          57-MSE     68-MSE

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'