Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:98
 aligned with ZN174_HUMAN | Q15697 from UniProtKB/Swiss-Prot  Length:407

    Alignment length:101
                                    41        51        61        71        81        91       101       111       121       131 
          ZN174_HUMAN    32 GPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPK 132
               SCOP domains -----d1y7qa1 A:37-132 Zinc finger protein 174                                                         SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..---......hhhhhhhhh........hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.hhhhhhhhh....hhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------SCAN_BOX  PDB: A:46-126 UniProt: 46-126                                          ------ PROSITE
               Transcript 1 Exon 1.1b  PDB: A:35-132 (gaps) UniProt: 1-134 [INCOMPLETE]                                           Transcript 1
                 1Y7Q A  35 GS---KNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPEEIQARVRHRCLMSSKEIVTLVEDFHRASKKPK 132
                             |   |  41        51        61        71        81        91       101       111       121       131 
                             |  37                                                                                               
                            36                                                                                                   

Chain B from PDB  Type:PROTEIN  Length:98
 aligned with ZN174_HUMAN | Q15697 from UniProtKB/Swiss-Prot  Length:407

    Alignment length:101
                                    41        51        61        71        81        91       101       111       121       131 
          ZN174_HUMAN    32 GPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPK 132
               SCOP domains d1   y7qb_ B: Zinc finger protein 174                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------SCAN-1y7qB01 B:40-132                                                                         Pfam domains (1)
           Pfam domains (2) --------SCAN-1y7qB02 B:40-132                                                                         Pfam domains (2)
         Sec.struct. author ..---......hhhhhhhh..........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.hhhhhhhh.....hhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------SCAN_BOX  PDB: B:46-126 UniProt: 46-126                                          ------ PROSITE
               Transcript 1 Exon 1.1b  PDB: B:35-132 (gaps) UniProt: 1-134 [INCOMPLETE]                                           Transcript 1
                 1Y7Q B  35 GS---KNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPEEIQARVRHRCLMSSKEIVTLVEDFHRASKKPK 132
                             |   |  41        51        61        71        81        91       101       111       121       131 
                            36  37                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'