Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:153
 aligned with UB2D3_HUMAN | P61077 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:153
                                  1                                                                                                                                                  
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144   
          UB2D3_HUMAN     - ------MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
               SCOP domains ------d1x23a1 A:1-147 Ubiquitin conjugating enzyme, UBC                                                                                                   SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------UBIQUITIN_CONJUGAT_2  PDB: A:4-136 UniProt: 4-136                                                                                    ----------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------UBIQUITIN_CONJUG---------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ------1.3d    Exon 1.6c  PDB: A:9-30----------Exon 1.9c  PDB: A:41-66   -----------------------------------Exon 1.10b  PDB: A:102-133      -------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------Exon 1.7b  --------------------------Exon 1.9l  PDB: A:67-102            ------------------------------Exon 1.12n      Transcript 1 (2)
                 1X23 A  -6 LGSPEFMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
                                 ||  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144   
                                -1|                                                                                                                                                  
                                  1                                                                                                                                                  

Chain B from PDB  Type:PROTEIN  Length:152
 aligned with UB2D3_HUMAN | P61077 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:152
                                 1                                                                                                                                                  
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145  
          UB2D3_HUMAN     - -----MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
               SCOP domains d1x23b_ B: automated matches                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------UBIQUITIN_CONJUGAT_2  PDB: B:4-136 UniProt: 4-136                                                                                    ----------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------UBIQUITIN_CONJUG---------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) -----1.3d    Exon 1.6c  PDB: B:9-30----------Exon 1.9c  PDB: B:41-66   -----------------------------------Exon 1.10b  PDB: B:102-133      -------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.7b  --------------------------Exon 1.9l  PDB: B:67-102            ------------------------------Exon 1.12n      Transcript 1 (2)
                 1X23 B  -5 GSPEFMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
                                ||   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145  
                               -1|                                                                                                                                                  
                                 1                                                                                                                                                  

Chain C from PDB  Type:PROTEIN  Length:152
 aligned with UB2D3_HUMAN | P61077 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:152
                                 1                                                                                                                                                  
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145  
          UB2D3_HUMAN     - -----MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
               SCOP domains d1x23c_ C: automated matches                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------UBIQUITIN_CONJUGAT_2  PDB: C:4-136 UniProt: 4-136                                                                                    ----------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------UBIQUITIN_CONJUG---------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) -----1.3d    Exon 1.6c  PDB: C:9-30----------Exon 1.9c  PDB: C:41-66   -----------------------------------Exon 1.10b  PDB: C:102-133      -------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.7b  --------------------------Exon 1.9l  PDB: C:67-102            ------------------------------Exon 1.12n      Transcript 1 (2)
                 1X23 C  -5 GSPEFMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
                                ||   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145  
                               -1|                                                                                                                                                  
                                 1                                                                                                                                                  

Chain D from PDB  Type:PROTEIN  Length:154
 aligned with UB2D3_HUMAN | P61077 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:154
                                   1                                                                                                                                                  
                                   | 3        13        23        33        43        53        63        73        83        93       103       113       123       133       143    
          UB2D3_HUMAN     - -------MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
               SCOP domains d1x23d_ D: automated matches                                                                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------UQ_con-1x23D01 D:5-142                                                                                                                    ----- Pfam domains (1)
           Pfam domains (2) -----------UQ_con-1x23D02 D:5-142                                                                                                                    ----- Pfam domains (2)
           Pfam domains (3) -----------UQ_con-1x23D03 D:5-142                                                                                                                    ----- Pfam domains (3)
           Pfam domains (4) -----------UQ_con-1x23D04 D:5-142                                                                                                                    ----- Pfam domains (4)
         Sec.struct. author .....hhhhhhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------UBIQUITIN_CONJUGAT_2  PDB: D:4-136 UniProt: 4-136                                                                                    ----------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------UBIQUITIN_CONJUG---------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) -------1.3d    Exon 1.6c  PDB: D:9-30----------Exon 1.9c  PDB: D:41-66   -----------------------------------Exon 1.10b  PDB: D:102-133      -------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.7b  --------------------------Exon 1.9l  PDB: D:67-102            ------------------------------Exon 1.12n      Transcript 1 (2)
                 1X23 D  -7 PLGSPEFMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
                                  || 3        13        23        33        43        53        63        73        83        93       103       113       123       133       143    
                                 -1|                                                                                                                                                  
                                   1                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'