Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with NEB1_HUMAN | Q9ULJ8 from UniProtKB/Swiss-Prot  Length:1098

    Alignment length:237
                                   424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       
           NEB1_HUMAN   415 GETGTEQDEEEDSDENSYYQPDMEYSEIVGLPEEEEIPANRKIKFSSAPIKVFNTYSNEDYDRRNDEVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLEQHYAQYDADDDETGEYATDEEEDEVGPVLPGSD 651
               SCOP domains -------------------------------------------------------------------------------------d1wf8a1 A:8-101 Neurabin-i                                                                    ---------------------------------------------------------- SCOP domains
               CATH domains 1wf8                                         A00                                      A:1-107  [code=2.30.42.10, no name defined]                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-----------------------------------------...-------------------------------------eeeeeeeee.......eeeeeeee.......eeeeeeeee...hhhhhhh.......eeee..ee....hhhhhhhhhhhh..eeeeeeeee...-------------------------------------------------.---.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------PDZ  PDB: A:12-100 UniProt: 504-592                                                      ----------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: A:1-7 (gaps) UniProt: 1-465        Exon 1.6  PDB: A:8-18 UniProt: 466-510       ---------------------------------------Exon 1.8  PDB: A:58-93              ---------------------------------------------Exon 1.11             Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------Exon 1.7  PDB: A:18-58 UniProt: 510-550  ----------------------------------Exon 1.9  PDB: A:93-102 UniProt: 585-630      --------------------- Transcript 1 (2)
                 1WF8 A   1 GSSG-----------------------------------------SSG-------------------------------------LELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPS-------------------------------------------------G---PSSG 107
                               |     -         -         -         -     | | -         -         -         -     |  12        22        32        42        52        62        72        82        92       102         -         -         -         -       103   |   
                               4                                         5 7                                     8                                                                                           102                                               103 104   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'