Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:DNA  Length:36
                                                                    
                 1U3E A   2 GTAATGAGCCTAACGCTCAGCAATTCCCACGTAAGA  37
                                    11        21        31      

Chain B from PDB  Type:DNA  Length:21
                                                     
                 1U3E B   2 CTTACGTGGGAATTGCTGAGC  22
                                    11        21 

Chain C from PDB  Type:DNA  Length:15
                                               
                 1U3E C  23 GTTAGGCTCATTACT  37
                                    32     

Chain M from PDB  Type:PROTEIN  Length:174
 aligned with HMUI_BPSP1 | P34081 from UniProtKB/Swiss-Prot  Length:174

    Alignment length:174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    
           HMUI_BPSP1     1 MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKGKTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQMSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRGKVTDVLKGHRIHHKGYTFRYKLNG 174
               SCOP domains d1u3em1 M:1-105 Intron-encoded homing endonuclease I-HmuI                                                d1u3em2 M:106-174 Intron-encoded homing endonuclease I-HmuI           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------1u3eM02 M:107-174 'winged helix' repressor DNA binding domain        CATH domains
               Pfam domains NUMOD4-1u3eM02 M:1-47                          -----HNH_3-1u3eM01 M:53-98                         ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.......eeee....eee.....ee..........eeeeee..eeeeeehhhhhhhhhh.......eeee........hhh.eeeehhhhhhhhhhhhh...hhhhhhhhhhhh...eeee.....eeee.hhhhhhhhhh.hhhhhhhhhh.........eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1U3E M   1 MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKGKTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQMSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRGKVTDVLKGHRIHHKGYTFRYKLNG 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'