Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with HFQ_PSEAE | Q9HUM0 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:66
                                    15        25        35        45        55        65      
             HFQ_PSEAE    6 SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP 71
               SCOP domains d1u1sa1 A:6-71 Pleiotropic translational regulator Hfq             SCOP domains
               CATH domains 1u1sA00 A:6-71  [code=2.30.30.100, no name defined]                CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhh...eeeee....eeeeeeeee...eeeee....eeee...eeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1U1S A  6 SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP 71
                                    15        25        35        45        55        65      

Chain B from PDB  Type:PROTEIN  Length:66
 aligned with HFQ_PSEAE | Q9HUM0 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:66
                                    14        24        34        44        54        64      
             HFQ_PSEAE    5 HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL 70
               SCOP domains d1u1sb_ B: Pleiotropic translational regulator Hfq                 SCOP domains
               CATH domains 1u1sB00 B:5-70  [code=2.30.30.100, no name defined]                CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...eeeee....eeeeeeeee...eeeee....eeee...eeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1U1S B  5 HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL 70
                                    14        24        34        44        54        64      

Chain C from PDB  Type:PROTEIN  Length:65
 aligned with HFQ_PSEAE | Q9HUM0 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:65
                                    14        24        34        44        54        64     
             HFQ_PSEAE    5 HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVR 69
               SCOP domains d1u1sc_ C: Pleiotropic translational regulator Hfq                SCOP domains
               CATH domains 1u1sC00 C:5-69  [code=2.30.30.100, no name defined]               CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...eeeee....eeeeeeeee...eeeee....eeee...eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                  1U1S C  5 HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVR 69
                                    14        24        34        44        54        64     

Chain D from PDB  Type:PROTEIN  Length:66
 aligned with HFQ_PSEAE | Q9HUM0 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:66
                                    15        25        35        45        55        65      
             HFQ_PSEAE    6 SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP 71
               SCOP domains d1u1sd_ D: Pleiotropic translational regulator Hfq                 SCOP domains
               CATH domains 1u1sD00 D:6-71  [code=2.30.30.100, no name defined]                CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..eeeeee....eeeeeeeee...eeeee....eeee...eeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1U1S D  6 SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP 71
                                    15        25        35        45        55        65      

Chain E from PDB  Type:PROTEIN  Length:66
 aligned with HFQ_PSEAE | Q9HUM0 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:66
                                    13        23        33        43        53        63      
             HFQ_PSEAE    4 GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVR 69
               SCOP domains d1u1se_ E: Pleiotropic translational regulator Hfq                 SCOP domains
               CATH domains 1u1sE00 E:4-69  [code=2.30.30.100, no name defined]                CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh...eeeee....eeeeeeeee...eeeee...eeeee...eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1U1S E  4 GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVR 69
                                    13        23        33        43        53        63      

Chain F from PDB  Type:PROTEIN  Length:65
 aligned with HFQ_PSEAE | Q9HUM0 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:65
                                    14        24        34        44        54        64     
             HFQ_PSEAE    5 HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVR 69
               SCOP domains d1u1sf_ F: Pleiotropic translational regulator Hfq                SCOP domains
               CATH domains 1u1sF00 F:5-69  [code=2.30.30.100, no name defined]               CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...eeeee....eeeeeeeee...eeeee....eeee...eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                  1U1S F  5 HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVR 69
                                    14        24        34        44        54        64     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'