Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:426
 aligned with ANPRA_RAT | P18910 from UniProtKB/Swiss-Prot  Length:1057

    Alignment length:426
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448      
            ANPRA_RAT    29 SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGFD 454
               SCOP domains d1t34a_ A: Hormone binding domain of the atrial natriuretic peptide receptor                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1t34A01 A:1-127,A:285-372  [code=3.40.50.2300, no name defined]                                                                1t34A02 A:128-284,A:373-425  [code=3.40.50.2300, no name defined]                                                                                            1t34A01 A:1-127,A:285-372  [code=3.40.50.2300, no name defined]                         1t34A02 A:128-284,A:373-425                          - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee.........hhhhhhhhhhhhhhhhhh........eeeeeeee..........hhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhhhh..eee....hhhhhh......eee...hhhhhhhhhhhhhhhh....eeeeeee......hhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhh......eeeee........................hhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.eeeee..eeeee.........eeeeee......eeeeeee......eee....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------ANF_RECEPTORS     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1  PDB: A:1-209 UniProt: 1-237 [INCOMPLETE]                                                                                                                                                               ------------------------------------------------------------------Exon 2.3  PDB: A:276-313              Exon 2.4  PDB: A:314-359 UniProt: 342-387     ------------------------------Exon 2.6  PDB: A:390-426 [INCOMPLETE] Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 2.2  PDB: A:209-275 UniProt: 237-303                          -----------------------------------------------------------------------------------Exon 2.5  PDB: A:359-389       ------------------------------------- Transcript 2 (2)
                 1T34 A   1 SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGFD 426
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420      

Chain B from PDB  Type:PROTEIN  Length:421
 aligned with ANPRA_RAT | P18910 from UniProtKB/Swiss-Prot  Length:1057

    Alignment length:425
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448     
            ANPRA_RAT    29 SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF 453
               SCOP domains d1t34b_ B: Hormone binding domain of the atrial natriuretic peptide receptor                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1t34B01 B:1-127,B:285-372  [code=3.40.50.2300, no name defined]                                                                1t34B02 B:128-284,B:373-425  [code=3.40.50.2300, no name defined]                                                                                            1t34B01 B:1-127,B:285-372  [code=3.40.50.2300, no name defined]                         1t34B02 B:128-284,B:373-425                           CATH domains
           Pfam domains (1) ---------------------ANF_receptor-1t34B01 B:22-384                                                                                                                                                                                                                                                                                                                                              ----------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------ANF_receptor-1t34B02 B:22-384                                                                                                                                                                                                                                                                                                                                              ----------------------------------------- Pfam domains (2)
         Sec.struct. author .eeeeeeee.........hhhhhhhhhhhhhhhhhh........eeeeeeee..........hhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhhhh..eee....hhhhhh......eee...hhhhhhhhhhhhhhhh....eeeeeee......hhhhhhhhhhhhhhhhhh..eeeeeee...hhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhh.......eeeee...........----.........hhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.eeeee..eeeee.........eeeee........eeeeee......eee...................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------ANF_RECEPTORS     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1  PDB: B:1-209 UniProt: 1-237 [INCOMPLETE]                                                                                                                                                               ------------------------------------------------------------------Exon 2.3  PDB: B:276-313              Exon 2.4  PDB: B:314-359 UniProt: 342-387     ------------------------------Exon 2.6  PDB: B:390-425             Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 2.2  PDB: B:209-275 (gaps) UniProt: 237-303                   -----------------------------------------------------------------------------------Exon 2.5  PDB: B:359-389       ------------------------------------ Transcript 2 (2)
                 1T34 B   1 SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQ----QKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF 425
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250 |    |260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420     
                                                                                                                                                                                                                                                                                     252  257                                                                                                                                                                        

Chain H from PDB  Type:PROTEIN  Length:21
 aligned with ANF_RAT | P01161 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:21
                                   138       148 
              ANF_RAT   129 CFGGRIDRIGAQSGLGCNSFR 149
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author ..................... Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE NATRIURETIC_PEPTI---- PROSITE
               Transcript 1 Exon 1.2  PDB: H:7-27 Transcript 1
                 1T34 H   7 CFGGRIDRIGAQSGLGCNSFR  27
                                    16        26 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'