Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:388
 aligned with SYWC_HUMAN | P23381 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:388
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461        
           SYWC_HUMAN    82 EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD 469
               SCOP domains d1r6ua_ A: Tryptophanyl-tRNA synthetase (TrpRS)                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1r6uA01 A:82-339 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                            1r6uA02 A:340-469 Tyrosyl-Transfer RNA Synthetase                                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eee..........hhhhhh..ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhh....eeeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh...hhh.eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhhh....eeeee...ee..eeeee..............hhhhhhhhhhhh.......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D-------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------AA_TRNA_LIG------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: A:82-105 -----------------------------------Exon 1.6  PDB: A:141-181 UniProt: 141-181------------------------------------------------------------Exon 1.8  PDB: A:242-276           -------------------------------------Exon 1.10  PDB: A:314-371 UniProt: 314-371                Exon 1.11  PDB: A:372-418 UniProt: 372-418     Exon 1.12b  PDB: A:419-469 UniProt: 419-471         Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.5  PDB: A:105-141             ---------------------------------------Exon 1.7  PDB: A:181-242 UniProt: 181-242                     ---------------------------------Exon 1.9  PDB: A:276-313              ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1R6U A  82 EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDmNQVLDAYENKKPFYLYTGRGPSSEAmHVGHLIPFIFTKWLQDVFNVPLVIQmTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYmGmSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRmTRDVAPRIGYPKPALLHSTFFPALQGAQTKmSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFmYLTFFLEDDDKLEQIRKDYTSGAmLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFmTPRKLSFD 469
                                    91       101       111       121       131       141 |     151       161       171       181       191   |   201       211       221       231       241 |     251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421   |   431       441       451       461        
                                                                                       143-MSE                   169-MSE                   195-MSE                                       241-MSE                                                                       319-MSE                        350-MSE                                            401-MSE                 425-MSE                             461-MSE    
                                                                                                                                                                                           243-MSE                                                                                                                                                                                                                              

Chain B from PDB  Type:PROTEIN  Length:362
 aligned with SYWC_HUMAN | P23381 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:371
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466 
           SYWC_HUMAN    97 GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLS 467
               SCOP domains d1r6ub_ B: Tryptophanyl-tRNA synthetase (TrpRS)                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1r6uB01 B:97-345 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                   ---------1r6uB02 B:355-467 Tyrosyl-Transfer RNA Synthetase                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.ee.hhhhhhhhhhhhh.............eeehhhhhhhhhhh....eeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhhh......eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee..hhhhhhhhhhhhhhh.....eeeee........---------.........hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------AA_TRNA_LIG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4 -----------------------------------Exon 1.6  PDB: B:141-181 UniProt: 141-181------------------------------------------------------------Exon 1.8  PDB: B:242-276           -------------------------------------Exon 1.10  PDB: B:314-371 (gaps) UniProt: 314-371         Exon 1.11  PDB: B:372-418 UniProt: 372-418     Exon 1.12b  PDB: B:419-467 UniProt: 419-471       Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.5  PDB: B:105-141             ---------------------------------------Exon 1.7  PDB: B:181-242 UniProt: 181-242                     ---------------------------------Exon 1.9  PDB: B:276-313              ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1R6U B  97 GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDmNQVLDAYENKKPFYLYTGRGPSSEAmHVGHLIPFIFTKWLQDVFNVPLVIQmTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYmGmSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRmTRDVAPRIGYPKPALLHSTFFPALQG---------PNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFmYLTFFLEDDDKLEQIRKDYTSGAmLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFmTPRKLS 467
                                   106       116       126       136      |146       156       166  |    176       186       196       206       216       226       236    | |246       256       266       276       286       296       306       316  |    326       336        |-       356       366       376       386       396    |  406       416       426       436       446       456    |  466 
                                                                        143-MSE                   169-MSE                   195-MSE                                       241-MSE                                                                       319-MSE                   345       355                                           401-MSE                 425-MSE                             461-MSE  
                                                                                                                                                                            243-MSE                                                                                                                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'