Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:52
 aligned with HP1_DROME | P05205 from UniProtKB/Swiss-Prot  Length:206

    Alignment length:52
                                    32        42        52        62        72  
             HP1_DROME   23 EYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR 74
               SCOP domains d1q3la_ A: Heterochromatin protein 1, HP1            SCOP domains
               CATH domains 1q3lA00 A:23-74  [code=2.40.50.40, no name defined]  CATH domains
               Pfam domains -Chromo-1q3lA01 A:24-73                            - Pfam domains
         Sec.struct. author .eeeeeeeeeeee..eeeeeeee...hhhhheeee...eehhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -CHROMO_2  PDB: A:24-74 UniProt: 24-82               PROSITE (1)
                PROSITE (2) ------------------CHROMO_1  PDB: A:41-6------------- PROSITE (2)
                 Transcript ---------------------------------------------------- Transcript
                  1Q3L A 23 EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR 74
                                    32        42        52        62        72  

Chain P from PDB  Type:PROTEIN  Length:6
 aligned with H31_BOVIN | P68432 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:6
             H31_BOVIN    6 QTARKS 11
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author .ee... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                  1Q3L P  5 QTARkS 10
                                | 
                                | 
                                9-MLZ

Chain P from PDB  Type:PROTEIN  Length:6
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:6
             H31_HUMAN    6 QTARKS 11
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author .ee... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                  1Q3L P  5 QTARkS 10
                                | 
                                9-MLZ

Chain P from PDB  Type:PROTEIN  Length:6
 aligned with H31_MOUSE | P68433 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:6
             H31_MOUSE    6 QTARKS 11
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author .ee... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                  1Q3L P  5 QTARkS 10
                                | 
                                9-MLZ

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'