Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:213
 aligned with NMNA3_HUMAN | Q96T66 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:233
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232   
          NMNA3_HUMAN     3 SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK 235
               SCOP domains d1nupa_ A: Cytosolic NMN/NAMN adenylyltransferase                                                                                                                                                                                         SCOP domains
               CATH domains 1nupA00 A:3-235 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee...........hhhhhhhhhhhhhhhh..eee.hhhhhh....hhhhhhhhhhhhhh--------------------...eeeeeeehhhhhhh......hhhhhhhhhhhh.eeee.....hhhhhhhhhhhhhhh...eeee........hhhhhhhhhhh........hhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:3-37 [INCOMPLETE]------------------------------------------------------------Exon 1.10b UniProt: 98-126   ------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.8  PDB: A:37-98 UniProt: 37-98                         ---------------------------Exon 1.12e  PDB: A:126-235 UniProt: 126-252 [INCOMPLETE]                                                       Transcript 1 (2)
                 1NUP A   3 SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLL--------------------AVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK 235
                                    12        22        32        42        52        62        72        82        92       102  |      -         -   |   132       142       152       162       172       182       192       202       212       222       232   
                                                                                                                                105                  126                                                                                                             

Chain B from PDB  Type:PROTEIN  Length:212
 aligned with NMNA3_HUMAN | Q96T66 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:232
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232  
          NMNA3_HUMAN     3 SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYT 234
               SCOP domains d1nupb_ B: Cytosolic NMN/NAMN adenylyltransferase                                                                                                                                                                                        SCOP domains
               CATH domains 1nupB00 B:3-234 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.....hhhhhhhhhhhhhhhhhhh.eeeeeeeeee...........hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhhh--------------------..eeeeeeehhhhhhh......hhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhh.eeee........hhhhhhhhhhh........hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: B:3-37 [INCOMPLETE]------------------------------------------------------------Exon 1.10b  PDB: B:98-106    ------------------------------------------------------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.8  PDB: B:37-98 UniProt: 37-98                         ---------------------------Exon 1.12e  PDB: B:127-234 UniProt: 126-252 [INCOMPLETE]                                                      Transcript 1 (2)
                 1NUP B   3 SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLR--------------------VPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYT 234
                                    12        22        32        42        52        62        72        82        92       102   |     -         -    |  132       142       152       162       172       182       192       202       212       222       232  
                                                                                                                                 106                  127                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'