Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:47
 aligned with SWI5_YEAST | P08153 from UniProtKB/Swiss-Prot  Length:709

    Alignment length:47
                                   541       551       561       571       
           SWI5_YEAST   532 TLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDR 578
               SCOP domains d1ncsa_ A: SWI5 zinc-finger domains             SCOP domains
               CATH domains 1ncsA00 A:14-60 Classic Zinc Finger             CATH domains
               Pfam domains ------------------zf-C2H2-1ncsA01 A:32-56  ---- Pfam domains
         Sec.struct. author .....hhhhhheee...eeee......eeee.hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------ZINC_FINGER_C2H2_1     ---- PROSITE
               Transcript 1 Exon 1.1  PDB: A:14-60 UniProt: 1-709           Transcript 1
                 1NCS A  14 TLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDR  60
                                    23        33        43        53       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'