Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:153
 aligned with IL19_HUMAN | Q9UHD0 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:156
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171      
           IL19_HUMAN    22 NHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA 177
               SCOP domains d1n1fa_ A: Interleukin-19                                                                                                                                    SCOP domains
               CATH domains 1n1fA00 A:4-159  [code=1.20.1250.10, no name defined]                                                                                                        CATH domains
               Pfam domains IL10-1n1fA01 A:4-155                                                                                                                                    ---- Pfam domains
         Sec.struct. author hhhhhh.....hhhhhhhhhhhhhhhhhh.........hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh---....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------S-- SAPs(SNPs)
                    PROSITE ------------------------------------------------INTERLEUKIN_10       --------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4a  PDB: A:4-30     Exon 1.5  PDB: A:31-52Exon 1.6a  PDB: A:53-103 UniProt: 71-121           Exon 1.7 UniProt: 122-146Exon 1.8a  PDB: A:129-159       Transcript 1
                 1N1F A   4 NHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQ---QCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA 159
                                    13        23        33        43        53        63        73        83        93       103|   |  113       123       133       143       153      
                                                                                                                              104 108                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'