Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:123
 aligned with SMAD3_HUMAN | P84022 from UniProtKB/Swiss-Prot  Length:425

    Alignment length:123
                                    19        29        39        49        59        69        79        89        99       109       119       129   
         SMAD3_HUMAN     10 PIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET  132
               SCOP domains d1mhda_ A: SMAD MH1 domain                                                                                                  SCOP domains
               CATH domains 1mhdA00 A:10-132 Smad3; Chain A                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh........hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh........eee.....eeee..eeeehhhhhhhhh..........eee.............eee..hhheee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------V-------------------- SAPs(SNPs)
                    PROSITE MH1  PDB: A:10-132 UniProt: 10-136                                                                                          PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:10-69 UniProt: 1-69 [INCOMPLETE]           --------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------Exon 1.3  PDB: A:69-132 UniProt: 69-134 [INCOMPLETE]             Transcript 1 (2)
                1MHD A   10 PIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET  132
                                    19        29        39        49        59        69        79        89        99       109       119       129   

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with SMAD3_HUMAN | P84022 from UniProtKB/Swiss-Prot  Length:425

    Alignment length:123
                                    19        29        39        49        59        69        79        89        99       109       119       129   
         SMAD3_HUMAN     10 PIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET  132
               SCOP domains d1mhdb_ B: SMAD MH1 domain                                                                                                  SCOP domains
               CATH domains 1mhdB00 B:10-132 Smad3; Chain A                                                                                             CATH domains
           Pfam domains (1) ---------------------MH1-1mhdB01 B:31-131                                                                                 - Pfam domains (1)
           Pfam domains (2) ---------------------MH1-1mhdB02 B:31-131                                                                                 - Pfam domains (2)
         Sec.struct. author .hhhhhhh........hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh........eee.....eeee..eeeehhhhhhhhh..........eee.............eee..hhheee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------V-------------------- SAPs(SNPs)
                    PROSITE MH1  PDB: B:10-132 UniProt: 10-136                                                                                          PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:10-69 UniProt: 1-69 [INCOMPLETE]           --------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------Exon 1.3  PDB: B:69-132 UniProt: 69-134 [INCOMPLETE]             Transcript 1 (2)
                1MHD B   10 PIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET  132
                                    19        29        39        49        59        69        79        89        99       109       119       129   

Chain C from PDB  Type:DNA  Length:13
                                              
                1MHD C 1001 CAGTCTAGACATA 1013
                                  1010   

Chain D from PDB  Type:DNA  Length:14
                                               
                1MHD D 2001 TATGTCTAGACTGA 2014
                                  2010    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'