Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:84
 aligned with UBF1_HUMAN | P17480 from UniProtKB/Swiss-Prot  Length:764

    Alignment length:84
                                   488       498       508       518       528       538       548       558    
           UBF1_HUMAN   479 GKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMK 562
               SCOP domains d1l8za_ A: Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1)       SCOP domains
               CATH domains 1l8zA00 A:1-84 DNA Binding (I), subunit A                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---HMG_BOX_2  PDB: A:4-71 UniProt: 482-549                             ------------- PROSITE
               Transcript 1 Exon 1.17  PDB: A:1-27     Exon 1.18a  PDB: A:28-64             Exon 1.19            Transcript 1
                 1L8Z A   1 GKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKLE  84
                                    10        20        30        40        50        60        70        80    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'