Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:101
 aligned with DACH1_HUMAN | Q9UI36 from UniProtKB/Swiss-Prot  Length:760

    Alignment length:144
                                   150       160       170       180       190       200       210       220       230       240       250       260       270       280    
          DACH1_HUMAN   141 GSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNA 284
               SCOP domains d1                                           l8ra_ A: Retinal determination protein Dachshund                                                    SCOP domains
               CATH domains 1l                                           8rA00 A:182-282 Putative DNA-binding domain                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .h-------------------------------------------hhhh.eeeee..eeeeeeee..eeeeehhhhhhhhh.....hhhhhhhhhhhh....ee.hhhhhhhhhhh..........eeeehhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1L8R A 182 GS-------------------------------------------QNNECKmVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNA 282
                             |       -         -         -         -     | 188 |     198       208       218       228       238       248       258       268       278    
                             |                                         184     |                                                                                            
                           183                                               190-MSE                                                                                        

Chain B from PDB  Type:PROTEIN  Length:99
 aligned with DACH1_HUMAN | Q9UI36 from UniProtKB/Swiss-Prot  Length:760

    Alignment length:99
                                   195       205       215       225       235       245       255       265       275         
          DACH1_HUMAN   186 QNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNA 284
               SCOP domains d1l8rb_ B: Retinal determination protein Dachshund                                                  SCOP domains
               CATH domains 1l8rB00 B:184-282 Putative DNA-binding domain                                                       CATH domains
           Pfam domains (1) Ski_Sno-1l8rB01 B:184-280                                                                        -- Pfam domains (1)
           Pfam domains (2) Ski_Sno-1l8rB02 B:184-280                                                                        -- Pfam domains (2)
         Sec.struct. author ....eeeeee..eeeeeeee..eeeeehhhhhhhhh....hhhhhhhhhhhhh....ee.hhhhhhhhhhh..........eeeehhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 1L8R B 184 QNNECKmVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNA 282
                                  |193       203       213       223       233       243       253       263       273         
                                190-MSE                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'