Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:216
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:253
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254   
          NMNA1_HUMAN     5 EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE 257
               SCOP domains d1kkua_ A: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                              SCOP domains
               CATH domains 1kkuA00 A:5-257 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                         CATH domains
               Pfam domains -------CTP_transf_2-1kkuA01 A:12-229                                                                                                                                                                                             ---------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee...........hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhhh..-------------------------------------..eeeeeehhhhhhhhhh....hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhh...... Sec.struct. author
             SAPs(SNPs) (1) ----M---T------N------------G-T------------------V-----------WF-V--H-------------------------G----------------------------------------------------F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:5-39 [INCOMPLETE]------------------------------------------------------------Exon 1.4a  PDB: A:100-110 UniProt: 100-147      -------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.3  PDB: A:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: A:148-257 UniProt: 147-279 [INCOMPLETE]                                                         Transcript 1 (2)
                 1KKU A   5 EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASD-------------------------------------VPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWFANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE 257
                                    14        24        34        44        54        64        74        84        94       104     |   -         -         -         -   |   154       164       174       184       194       204       214       224       234       244       254   
                                                                                                                                   110                                   148                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'