Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:407
 aligned with ANPRC_HUMAN | P17342 from UniProtKB/Swiss-Prot  Length:541

    Alignment length:414
                                    59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459    
          ANPRC_HUMAN    50 PQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENR 463
               SCOP domains d1jdna_ A: Hormone binding domain of        the atrial natriuretic peptide receptor                                                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1jdnA02 A:5-134,A:284-368  [code=3.4       0.50.2300, no name defined]                                                            1jdnA01 A:135-281,A:369-400  [code=3.40.50.2300, no name defined]                                                                                  --1jdnA02 A:5-134,A:284-368  [code=3.40.50.2300, no name defined]                      1jdnA01 A:135-281,A:369-400     ------------------ CATH domains
               Pfam domains ---------------------ANF_receptor-1j       dnA01 A:26-379                                                                                                                                                                                                                                                                                                                              --------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee........hhhhhhhhhhhhhhhhh.-------......eeeeeee....hhhhhhhhhhhhhh......eee...hhhhhhhhhhhhhhh...eee....hhhhhh.......eee....hhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh.......eeeee.hhhhhhhh.........hhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.eeeee..eeeee........eeeeeeeee....eeeeeeeee....eeee........hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------ANF_RECEPTORS     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3a  PDB: A:5-212 (gaps) UniProt: 1-257 [INCOMPLETE]                                                                                                                                                      ----------------------------------------Exon 1.6  PDB: A:253-308 UniProt: 298-353               Exon 1.7  PDB: A:309-354 UniProt: 354-399     -------------------------------Exon 1.9a  PDB: A:386-418         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: A:212-253 UniProt: 257-298 ----------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:354-385        --------------------------------- Transcript 1 (2)
                 1JDN A   5 PQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEG-------LPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENR 418
                                    14        24        34     |   -   |    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414    
                                                              40      48                                                                                                                                                                                                                                                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'