Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with NHP6A_YEAST | P11632 from UniProtKB/Swiss-Prot  Length:93

    Alignment length:93
                                    10        20        30        40        50        60        70        80        90   
          NHP6A_YEAST     1 MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNATLA  93
               SCOP domains d1j5na_ A: NHP6a                                                                              SCOP domains
               CATH domains 1j5nA00 A:1-93 DNA Binding (I), subunit A                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........................hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------HMG_BOX_2  PDB: A:21-89 UniProt: 21-89                               ---- PROSITE
               Transcript 1 Exon 1.1  PDB: A:1-93 UniProt: 1-93                                                           Transcript 1
                 1J5N A   1 MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNATLA  93
                                    10        20        30        40        50        60        70        80        90   

Chain B from PDB  Type:DNA  Length:15
                                               
                 1J5N B 101 GGGGTGATTGTTCAG 115
                                   110     

Chain C from PDB  Type:DNA  Length:15
                                               
                 1J5N C 116 CTGAACAATCACCCC 130
                                   125     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'