Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:71
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:71
                                    12        22        32        42        52        62        72 
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5la_ A: Archaeal homoheptameric Sm protein                           SCOP domains
               CATH domains 1i5lA00 A:3-73  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  1I5L A  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    12        22        32        42        52        62        72 

Chain B from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:73
                                    12        22        32        42        52        62        72   
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAPG 75
               SCOP domains d1i5lb_ B: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1i5lB00 B:3-75  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeeee...eeeeeeeeee........eeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1I5L B  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAPG 75
                                    12        22        32        42        52        62        72   

Chain C from PDB  Type:PROTEIN  Length:74
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:74
                                    10        20        30        40        50        60        70    
            RUXX_ARCFU    1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lc_ C: Archaeal homoheptameric Sm protein                              SCOP domains
               CATH domains 1i5lC00 C:1-74  [code=2.30.30.100, no name defined]                        CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1I5L C  1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    10        20        30        40        50        60        70    

Chain D from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:73
                                    11        21        31        41        51        61        71   
            RUXX_ARCFU    2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5ld_ D: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1i5lD00 D:2-74  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1I5L D  2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    11        21        31        41        51        61        71   

Chain E from PDB  Type:PROTEIN  Length:71
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:71
                                    12        22        32        42        52        62        72 
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5le_ E: Archaeal homoheptameric Sm protein                           SCOP domains
               CATH domains 1i5lE00 E:3-73  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  1I5L E  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    12        22        32        42        52        62        72 

Chain F from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lf_ F: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lF00 F:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeee......eeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L F  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain G from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lg_ G: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lG00 G:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L G  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain H from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lh_ H: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lH00 H:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L H  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain I from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:73
                                    10        20        30        40        50        60        70   
            RUXX_ARCFU    1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5li_ I: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1i5lI00 I:1-73  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1I5L I  1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    10        20        30        40        50        60        70   

Chain J from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lj_ J: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lJ00 J:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..ee...eeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L J  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain K from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lk_ K: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lK00 K:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L K  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain L from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5ll_ L: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lL00 L:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L L  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain M from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    11        21        31        41        51        61        71  
            RUXX_ARCFU    2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5lm_ M: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lM00 M:2-73  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeee......eeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1I5L M  2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    11        21        31        41        51        61        71  

Chain N from PDB  Type:PROTEIN  Length:71
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:71
                                    12        22        32        42        52        62        72 
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5ln_ N: Archaeal homoheptameric Sm protein                           SCOP domains
               CATH domains 1i5lN00 N:3-73  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  1I5L N  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    12        22        32        42        52        62        72 

Chain U from PDB  Type:RNA  Length:3
                                  
                  1I5L U  1 UUU  3

Chain Y from PDB  Type:RNA  Length:3
                                  
                  1I5L Y  1 UUU  3

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'