Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:73
 aligned with SRY_HUMAN | Q05066 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:73
                                    67        77        87        97       107       117       127   
            SRY_HUMAN    58 DRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR 130
               SCOP domains d1hrya_ A: SRY                                                            SCOP domains
               CATH domains 1hryA00 A:3-75 DNA Binding (I), subunit A                                 CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
             SAPs(SNPs) (1) --A-G-I--VT------MS-T--------Y--MG---E-----H----I-RS---T-----------L-C--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --L---R------------------------------R-------------------------------F--- SAPs(SNPs) (2)
                    PROSITE --HMG_BOX_2  PDB: A:5-73 UniProt: 60-128                               -- PROSITE
               Transcript 1 Exon 1.1  PDB: A:3-75 UniProt: 1-236 [INCOMPLETE]                         Transcript 1
                 1HRY A   3 DRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR  75
                                    12        22        32        42        52        62        72   


Chain B from PDB  Type:DNA  Length:8
                                        
                 1HRY B   1 GCACAAAC   8


Chain C from PDB  Type:DNA  Length:8
                                        
                 1HRY C   1 GTTTGTGC   8
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'