Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:228
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:266
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265      
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
               SCOP domains d1gzua_ A: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                           SCOP domains
               CATH domains 1gzuA00 A:6-271 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeehhhhhhhh......hhhhhhhhhhhheeeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhh..................... Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L---------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:6-39            ------------------------------------------------------------Exon 1.4a  PDB: A:100-147 (gaps)                ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: A:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: A:147-271 UniProt: 147-279 [INCOMPLETE]                                                                       Transcript 1 (2)
                 1GZU A   6 KTEVVLLACGSFNPITNmHLRLFELAKDYmNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVImAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
                                    15       |25        35        45        55        65   |    75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265      
                                            23-MSE      35-MSE                            69-MSE                                108                                    147                                                                                                                            

Chain B from PDB  Type:PROTEIN  Length:228
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:266
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265      
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
               SCOP domains d1gzub_ B: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                           SCOP domains
               CATH domains 1gzuB00 B:6-271 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeehhhhhhhh......hhhhhhhhhhhheeeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhh..................... Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L---------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:6-39            ------------------------------------------------------------Exon 1.4a  PDB: B:100-147 (gaps)                ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: B:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: B:147-271 UniProt: 147-279 [INCOMPLETE]                                                                       Transcript 1 (2)
                 1GZU B   6 KTEVVLLACGSFNPITNmHLRLFELAKDYmNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVImAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
                                    15       |25        35        45        55        65   |    75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265      
                                            23-MSE      35-MSE                            69-MSE                                108                                    147                                                                                                                            

Chain C from PDB  Type:PROTEIN  Length:228
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:266
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265      
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
               SCOP domains d1gzuc_ C: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                           SCOP domains
               CATH domains 1gzuC00 C:6-271 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeehhhhhhhh......hhhhhhhhhhhheeeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhh..................... Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L---------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: C:6-39            ------------------------------------------------------------Exon 1.4a  PDB: C:100-147 (gaps)                ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: C:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: C:147-271 UniProt: 147-279 [INCOMPLETE]                                                                       Transcript 1 (2)
                 1GZU C   6 KTEVVLLACGSFNPITNmHLRLFELAKDYmNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVImAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
                                    15       |25        35        45        55        65   |    75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265      
                                            23-MSE      35-MSE                            69-MSE                                108                                    147                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'