Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:108
 aligned with NGF_MOUSE | P01139 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:108
                                   140       150       160       170       180       190       200       210       220       230        
            NGF_MOUSE   131 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKAT 238
               SCOP domains d1btga_ A: beta-Nerve growth factor                                                                          SCOP domains
               CATH domains 1btgA00 A:10-117 Cystine-knot cytokines                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeee....eee.....eee...eeee..eeee..eeeeee.................eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------NGF_1         ------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1BTG A  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKAT 117
                                    19        29        39        49        59        69        79        89        99       109        

Chain B from PDB  Type:PROTEIN  Length:109
 aligned with NGF_MOUSE | P01139 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:109
                                   140       150       160       170       180       190       200       210       220       230         
            NGF_MOUSE   131 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR 239
               SCOP domains d1btgb_ B: beta-Nerve growth factor                                                                           SCOP domains
               CATH domains 1btgB00 B:10-118 Cystine-knot cytokines                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee....eee.....eee...eee....eee..eeeeee.................eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------NGF_1         -------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1BTG B  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR 118
                                    19        29        39        49        59        69        79        89        99       109         

Chain C from PDB  Type:PROTEIN  Length:109
 aligned with NGF_MOUSE | P01139 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:109
                                   140       150       160       170       180       190       200       210       220       230         
            NGF_MOUSE   131 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR 239
               SCOP domains d1btgc_ C: beta-Nerve growth factor                                                                           SCOP domains
               CATH domains 1btgC00 C:10-118 Cystine-knot cytokines                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee....eee.....eee...eee....eee..eeeeee.................eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------NGF_1         -------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1BTG C  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR 118
                                    19        29        39        49        59        69        79        89        99       109         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'