Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  SINGLE STRANDED DNA BINDING PROTEIN AND SSDNA COMPLEX
 
Authors :  T. Matsumoto, Y. Morimoto, N. Shibata, N. Yasuoka, N. Shimamoto
Date :  06 Apr 00  (Deposition) - 23 Sep 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B,C,D,M,N
Keywords :  Beta Barrel, Protein-Dna Complex, Replication/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Matsumoto, Y. Morimoto, N. Shibata, T. Kinebuchi, N. Shimamoto, T. Tsukihara, N. Yasuoka
Roles Of Functional Loops And The C-Terminal Segment Of A Single-Stranded Dna Binding Protein Elucidated By X-Ray Structure Analysis
J. Biochem. (Tokyo) V. 127 329 2000
PubMed-ID: 10731701
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5'-R(*(5MU)P*(5MU)P*(5MU))-3'
    ChainsM, N
    EngineeredYES
    SyntheticYES
 
Molecule 2 - SINGLE STRANDED DNA BINDING PROTEIN
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymSSB, HELIX-DESTABILIZING PROTEIN

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCDMN

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
15MU4Mod. Nucleotide5-METHYLURIDINE 5'-MONOPHOSPHATE

(-) Sites  (0, 0)

(no "Site" information available for 1EQQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EQQ)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Met B:223 -Pro B:224

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EQQ)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SSBPS50935 Single-strand binding (SSB) domain profile.SSB_SHIFL6-111
 
 
 
  4A:5-110
B:205-310
C:405-510
D:605-710
SSB_ECO576-111
 
 
 
  4A:5-110
B:205-310
C:405-510
D:605-710
SSB_ECOL66-111
 
 
 
  4A:5-110
B:205-310
C:405-510
D:605-710
SSB_ECOLI6-111
 
 
 
  4A:5-110
B:205-310
C:405-510
D:605-710

(-) Exons   (0, 0)

(no "Exon" information available for 1EQQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:114
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_ECO57     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqa_ A: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqA00 A:1-114 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................ee...ee...............................hhhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ----SSB  PDB: A:5-110 UniProt: 6-111                                                                          ---- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq A   1 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 114
                                    10        20        30        40        50        60        70        80        90       100       110    

Chain A from PDB  Type:PROTEIN  Length:114
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_ECOL6     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqa_ A: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqA00 A:1-114 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................ee...ee...............................hhhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----SSB  PDB: A:5-110 UniProt: 6-111                                                                          ---- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq A   1 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 114
                                    10        20        30        40        50        60        70        80        90       100       110    

Chain A from PDB  Type:PROTEIN  Length:114
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_ECOLI     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqa_ A: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqA00 A:1-114 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................ee...ee...............................hhhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----SSB  PDB: A:5-110 UniProt: 6-111                                                                          ---- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq A   1 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 114
                                    10        20        30        40        50        60        70        80        90       100       110    

Chain A from PDB  Type:PROTEIN  Length:114
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_SHIFL     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqa_ A: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqA00 A:1-114 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................ee...ee...............................hhhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ----SSB  PDB: A:5-110 UniProt: 6-111                                                                          ---- PROSITE (4)
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq A   1 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 114
                                    10        20        30        40        50        60        70        80        90       100       110    

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:120
                                    11        21        31        41        51        61        71        81        91       101       111       121
            SSB_ECO57     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 121
               SCOP domains d1eqqb_ B: ssDNA-binding protein                                                                                         SCOP domains
               CATH domains 1eqqB00 B:201-320 Nucleic acid-binding proteins                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................eeee......eeee.........hhhhhhhhhhh................................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ----SSB  PDB: B:205-310 UniProt: 6-111                                                                        ---------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq B 201 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 320
                                   210       220       230       240       250       260       270       280       290       300       310       320

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:120
                                    11        21        31        41        51        61        71        81        91       101       111       121
            SSB_ECOL6     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 121
               SCOP domains d1eqqb_ B: ssDNA-binding protein                                                                                         SCOP domains
               CATH domains 1eqqB00 B:201-320 Nucleic acid-binding proteins                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................eeee......eeee.........hhhhhhhhhhh................................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----SSB  PDB: B:205-310 UniProt: 6-111                                                                        ---------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq B 201 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 320
                                   210       220       230       240       250       260       270       280       290       300       310       320

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:120
                                    11        21        31        41        51        61        71        81        91       101       111       121
            SSB_ECOLI     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 121
               SCOP domains d1eqqb_ B: ssDNA-binding protein                                                                                         SCOP domains
               CATH domains 1eqqB00 B:201-320 Nucleic acid-binding proteins                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................eeee......eeee.........hhhhhhhhhhh................................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----SSB  PDB: B:205-310 UniProt: 6-111                                                                        ---------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq B 201 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 320
                                   210       220       230       240       250       260       270       280       290       300       310       320

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:120
                                    11        21        31        41        51        61        71        81        91       101       111       121
            SSB_SHIFL     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 121
               SCOP domains d1eqqb_ B: ssDNA-binding protein                                                                                         SCOP domains
               CATH domains 1eqqB00 B:201-320 Nucleic acid-binding proteins                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................eeee......eeee.........hhhhhhhhhhh................................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ----SSB  PDB: B:205-310 UniProt: 6-111                                                                        ---------- PROSITE (4)
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq B 201 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 320
                                   210       220       230       240       250       260       270       280       290       300       310       320

Chain C from PDB  Type:PROTEIN  Length:114
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_ECO57     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqc_ C: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqC00 C:401-514 Nucleic acid-binding proteins                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................ee..........ee.........hhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ----SSB  PDB: C:405-510 UniProt: 6-111                                                                        ---- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq C 401 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 514
                                   410       420       430       440       450       460       470       480       490       500       510    

Chain C from PDB  Type:PROTEIN  Length:114
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_ECOL6     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqc_ C: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqC00 C:401-514 Nucleic acid-binding proteins                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................ee..........ee.........hhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----SSB  PDB: C:405-510 UniProt: 6-111                                                                        ---- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq C 401 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 514
                                   410       420       430       440       450       460       470       480       490       500       510    

Chain C from PDB  Type:PROTEIN  Length:114
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_ECOLI     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqc_ C: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqC00 C:401-514 Nucleic acid-binding proteins                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................ee..........ee.........hhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----SSB  PDB: C:405-510 UniProt: 6-111                                                                        ---- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq C 401 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 514
                                   410       420       430       440       450       460       470       480       490       500       510    

Chain C from PDB  Type:PROTEIN  Length:114
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:114
                                    11        21        31        41        51        61        71        81        91       101       111    
            SSB_SHIFL     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 115
               SCOP domains d1eqqc_ C: ssDNA-binding protein                                                                                   SCOP domains
               CATH domains 1eqqC00 C:401-514 Nucleic acid-binding proteins                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................................ee..........ee.........hhhhhhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ----SSB  PDB: C:405-510 UniProt: 6-111                                                                        ---- PROSITE (4)
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1eqq C 401 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG 514
                                   410       420       430       440       450       460       470       480       490       500       510    

Chain D from PDB  Type:PROTEIN  Length:116
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:116
                                    11        21        31        41        51        61        71        81        91       101       111      
            SSB_ECO57     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 117
               SCOP domains d1eqqd_ D: ssDNA-binding protein                                                                                     SCOP domains
               CATH domains 1eqqD00 D:601-716 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................................eee........eee........hhhhhhhhhhhh............................................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----SSB  PDB: D:605-710 UniProt: 6-111                                                                        ------ PROSITE (3)
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1eqq D 601 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 716
                                   610       620       630       640       650       660       670       680       690       700       710      

Chain D from PDB  Type:PROTEIN  Length:116
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:116
                                    11        21        31        41        51        61        71        81        91       101       111      
            SSB_ECOL6     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 117
               SCOP domains d1eqqd_ D: ssDNA-binding protein                                                                                     SCOP domains
               CATH domains 1eqqD00 D:601-716 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................................eee........eee........hhhhhhhhhhhh............................................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----SSB  PDB: D:605-710 UniProt: 6-111                                                                        ------ PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1eqq D 601 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 716
                                   610       620       630       640       650       660       670       680       690       700       710      

Chain D from PDB  Type:PROTEIN  Length:116
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:116
                                    11        21        31        41        51        61        71        81        91       101       111      
            SSB_ECOLI     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 117
               SCOP domains d1eqqd_ D: ssDNA-binding protein                                                                                     SCOP domains
               CATH domains 1eqqD00 D:601-716 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................................eee........eee........hhhhhhhhhhhh............................................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SSB  PDB: D:605-710 UniProt: 6-111                                                                        ------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1eqq D 601 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 716
                                   610       620       630       640       650       660       670       680       690       700       710      

Chain D from PDB  Type:PROTEIN  Length:116
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:116
                                    11        21        31        41        51        61        71        81        91       101       111      
            SSB_SHIFL     2 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 117
               SCOP domains d1eqqd_ D: ssDNA-binding protein                                                                                     SCOP domains
               CATH domains 1eqqD00 D:601-716 Nucleic acid-binding proteins                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................................eee........eee........hhhhhhhhhhhh............................................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----SSB  PDB: D:605-710 UniProt: 6-111                                                                        ------ PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1eqq D 601 ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQ 716
                                   610       620       630       640       650       660       670       680       690       700       710      

Chain M from PDB  Type:RNA  Length:3
                                   
                 1eqq M 801 uuu 803
                            |||
                          801-5MU
                           802-5MU
                            803-5MU

Chain N from PDB  Type:RNA  Length:1
                                 
                 1eqq N 801 u 900
                               |
                               |
                             900-5MU

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EQQ)

(-) Gene Ontology  (14, 32)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (SSB_ECOL6 | P0AGE1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Chain A,B,C,D   (SSB_ECO57 | P0AGE2)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Chain A,B,C,D   (SSB_SHIFL | P0AGE3)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Chain A,B,C,D   (SSB_ECOLI | P0AGE0)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0009432    SOS response    An error-prone process for repairing damaged microbial DNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
    GO:0000725    recombinational repair    A DNA repair process that involves the exchange, reciprocal or nonreciprocal, of genetic material between the broken DNA molecule and a homologous region of DNA.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5MU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1eqq)
 
  Cis Peptide Bonds
    Met B:223 - Pro B:224   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1eqq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSB_ECO57 | P0AGE2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SSB_ECOL6 | P0AGE1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SSB_ECOLI | P0AGE0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SSB_SHIFL | P0AGE3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SSB_ECO57 | P0AGE2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SSB_ECOL6 | P0AGE1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SSB_ECOLI | P0AGE0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SSB_SHIFL | P0AGE3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SSB_ECO57 | P0AGE21kaw 1qvc 1sru
        SSB_ECOL6 | P0AGE11kaw 1qvc 1sru
        SSB_ECOLI | P0AGE01eyg 1kaw 1qvc 1sru 3c94 3sxu 3uf7 4mz9 4z0u
        SSB_SHIFL | P0AGE31kaw 1qvc 1sru

(-) Related Entries Specified in the PDB File

1qvc