Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  RHO TRANSCRIPTION TERMINATION FACTOR/RNA COMPLEX
 
Authors :  C. E. Bogden, D. Fass, N. Bergman, M. D. Nichols, J. M. Berger
Date :  08 Nov 98  (Deposition) - 26 Apr 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D,E
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,E  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Rho, Ob Fold, Single-Stranded Nucleic Acid Binding Domain, Protein/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. E. Bogden, D. Fass, N. Bergman, M. D. Nichols, J. M. Berger
The Structural Basis For Terminator Recognition By The Rho Transcription Termination Factor.
Mol. Cell V. 3 487 1999
PubMed-ID: 10230401  |  Reference-DOI: 10.1016/S1097-2765(00)80476-1
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5'-R(P*CP*CP*C)-3'
    ChainsD
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPET24B
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    StrainDH5A
 
Molecule 2 - 5'-R(P*CP*CP*CP*CP*CP*C)-3'
    ChainsE
    EngineeredYES
    SyntheticYES
 
Molecule 3 - RNA BINDING DOMAIN OF RHO TRANSCRIPTION TERMINATION FACTOR
    ChainsA, B, C
    EngineeredYES
    FragmentN-TERMINAL RNA BINDING DOMAIN
    SynonymRHO

 Structural Features

(-) Chains, Units

  12345
Asymmetric Unit ABCDE
Biological Unit 1 (1x)A  D 
Biological Unit 2 (1x) B  E
Biological Unit 3 (1x)  C  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2A8V)

(-) Sites  (0, 0)

(no "Site" information available for 2A8V)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2A8V)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2A8V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A8V)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2A8V)

(-) Exons   (0, 0)

(no "Exon" information available for 2A8V)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECO57 | P0AG32 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECO57     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8va1 A:1-47                                 d2a8va2 A:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vA01 A:1-47                                 2a8vA02 A:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhhhhhh....hhh..hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhhh......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v A   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain A from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECOL6 | P0AG31 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECOL6     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8va1 A:1-47                                 d2a8va2 A:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vA01 A:1-47                                 2a8vA02 A:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhhhhhh....hhh..hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhhh......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v A   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain A from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECOLI | P0AG30 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECOLI     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8va1 A:1-47                                 d2a8va2 A:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vA01 A:1-47                                 2a8vA02 A:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhhhhhh....hhh..hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhhh......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v A   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain A from PDB  Type:PROTEIN  Length:118
 aligned with RHO_SHIFL | P0AG33 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_SHIFL     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8va1 A:1-47                                 d2a8va2 A:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vA01 A:1-47                                 2a8vA02 A:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhhhhhh....hhh..hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhhh......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v A   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECO57 | P0AG32 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECO57     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vb1 B:1-47                                 d2a8vb2 B:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vB01 B:1-47                                 2a8vB02 B:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhh........eeeeee.........eeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v B   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECOL6 | P0AG31 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECOL6     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vb1 B:1-47                                 d2a8vb2 B:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vB01 B:1-47                                 2a8vB02 B:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhh........eeeeee.........eeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v B   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECOLI | P0AG30 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECOLI     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vb1 B:1-47                                 d2a8vb2 B:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vB01 B:1-47                                 2a8vB02 B:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhh........eeeeee.........eeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v B   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with RHO_SHIFL | P0AG33 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_SHIFL     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vb1 B:1-47                                 d2a8vb2 B:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vB01 B:1-47                                 2a8vB02 B:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh....eeeeeeeee.....eeee............eee.hhhhhh........eeeeee.........eeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v B   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECO57 | P0AG32 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECO57     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vc1 C:1-47                                 d2a8vc2 C:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vC01 C:1-47                                 2a8vC02 C:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh.....eeeeeeee.....eeee............eee.hhhhhh.......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v C   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECOL6 | P0AG31 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECOL6     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vc1 C:1-47                                 d2a8vc2 C:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vC01 C:1-47                                 2a8vC02 C:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh.....eeeeeeee.....eeee............eee.hhhhhh.......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v C   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with RHO_ECOLI | P0AG30 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_ECOLI     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vc1 C:1-47                                 d2a8vc2 C:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vC01 C:1-47                                 2a8vC02 C:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh.....eeeeeeee.....eeee............eee.hhhhhh.......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v C   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with RHO_SHIFL | P0AG33 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:118
                                    10        20        30        40        50        60        70        80        90       100       110        
            RHO_SHIFL     1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
               SCOP domains d2a8vc1 C:1-47                                 d2a8vc2 C:48-118 Rho termination factor, RNA-binding domain             SCOP domains
               CATH domains 2a8vC01 C:1-47                                 2a8vC02 C:48-117 Nucleic acid-binding proteins                        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhhhhh.........hhhhhhhhhhhhhh.....eeeeeeee.....eeee............eee.hhhhhh.......eeeeeee.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2a8v C   1 MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 118
                                    10        20        30        40        50        60        70        80        90       100       110        

Chain D from PDB  Type:RNA  Length:3
                                   
                 2a8v D   1 CCC   3

Chain E from PDB  Type:RNA  Length:6
                                      
                 2a8v E   1 CCCCCC   6

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A8V)

(-) Gene Ontology  (14, 44)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (RHO_ECOL6 | P0AG31)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0008186    RNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of RNA, and it drives another reaction.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006353    DNA-templated transcription, termination    The cellular process that completes DNA-templated transcription; the formation of phosphodiester bonds ceases, the RNA-DNA hybrid dissociates, and RNA polymerase releases the DNA.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain A,B,C   (RHO_SHIFL | P0AG33)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0008186    RNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of RNA, and it drives another reaction.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006353    DNA-templated transcription, termination    The cellular process that completes DNA-templated transcription; the formation of phosphodiester bonds ceases, the RNA-DNA hybrid dissociates, and RNA polymerase releases the DNA.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain A,B,C   (RHO_ECO57 | P0AG32)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0008186    RNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of RNA, and it drives another reaction.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006353    DNA-templated transcription, termination    The cellular process that completes DNA-templated transcription; the formation of phosphodiester bonds ceases, the RNA-DNA hybrid dissociates, and RNA polymerase releases the DNA.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain A,B,C   (RHO_ECOLI | P0AG30)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0008186    RNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of RNA, and it drives another reaction.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006353    DNA-templated transcription, termination    The cellular process that completes DNA-templated transcription; the formation of phosphodiester bonds ceases, the RNA-DNA hybrid dissociates, and RNA polymerase releases the DNA.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2a8v)
 
  Sites
(no "Sites" information available for 2a8v)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a8v)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a8v
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RHO_ECO57 | P0AG32
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RHO_ECOL6 | P0AG31
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RHO_ECOLI | P0AG30
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RHO_SHIFL | P0AG33
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RHO_ECO57 | P0AG32
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RHO_ECOL6 | P0AG31
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RHO_ECOLI | P0AG30
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RHO_SHIFL | P0AG33
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RHO_ECO57 | P0AG321a62 1a63 1a8v 5jji 5jjk 5jjl
        RHO_ECOL6 | P0AG311a62 1a63 1a8v
        RHO_ECOLI | P0AG301a62 1a63 1a8v 1pv4 1pvo 1xpo 1xpr 1xpu 2ht1 3ice 5jji 5jjk 5jjl
        RHO_SHIFL | P0AG331a62 1a63 1a8v

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2A8V)