Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TESTING THE WATER-MEDIATED HIN RECOMBINASE DNA RECOGNITION BY SYSTEMATIC MUTATIONS.
 
Authors :  T. K. Chiu, C. Sohn, R. C. Johnson, R. E. Dickerson
Date :  03 Jul 01  (Deposition) - 22 Feb 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Water-Mediated Recognition, Protein-Dna Complex, Hin Recombinase, I5, Dna Binding Protein/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. K. Chiu, C. Sohn, R. E. Dickerson, R. C. Johnson
Testing Water-Mediated Dna Recognition By The Hin Recombinase.
Embo J. V. 21 801 2002
PubMed-ID: 11847127  |  Reference-DOI: 10.1093/EMBOJ/21.4.801
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5'-D(*TP*GP*TP*(5IT) P*TP*TP*TP*GP*AP*TP*AP*AP*GP*A)-3'
    ChainsA
    EngineeredYES
    SyntheticYES
 
Molecule 2 - 5'-D(*AP*TP*CP*TP*TP*AP*TP*CP*AP*AP*AP*AP*AP*C)- 3'
    ChainsB
    EngineeredYES
    SyntheticYES
 
Molecule 3 - DNA-INVERTASE HIN
    ChainsC
    EngineeredYES
    FragmentRESIDUES 139 TO 190
    Other DetailsSYNTHETIC PEPTIDE
    SynonymHIN RECOMBINASE
    SyntheticYES

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
15IU1Mod. Nucleotide5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE
2TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREDG A:9 , DC B:23 , GLY C:170BINDING SITE FOR RESIDUE TRS C 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JJ6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JJ6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JJ6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JJ6)

(-) Exons   (0, 0)

(no "Exon" information available for 1JJ6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:DNA  Length:14
                                              
                 1jj6 A   2 TGTuTTTGATAAGA  15
                               |    11    
                               5-5IU      

Chain B from PDB  Type:DNA  Length:14
                                              
                 1jj6 B  16 ATCTTATCAAAAAC  29
                                    25    

Chain C from PDB  Type:PROTEIN  Length:47
 aligned with HIN_SALTY | P03013 from UniProtKB/Swiss-Prot  Length:190

    Alignment length:47
                                   148       158       168       178       
            HIN_SALTY   139 GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASRI 185
               SCOP domains d1jj6c_ C: HIN recombinase (DNA-binding domain) SCOP domains
               CATH domains 1jj6C00 C:139-185 Homeodomain-like              CATH domains
               Pfam domains HTH_7-1jj6C01 C:139-183                      -- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------- PROSITE
                 Transcript ----------------------------------------------- Transcript
                 1jj6 C 139 GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI 185
                                   148       158       168       178       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain C   (HIN_SALTY | P03013)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000150    recombinase activity    Catalysis of the identification and base-pairing of homologous sequences between single-stranded DNA and double-stranded DNA.
biological process
    GO:0015074    DNA integration    The process in which a segment of DNA is incorporated into another, usually larger, DNA molecule such as a chromosome.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5IU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jj6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jj6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HIN_SALTY | P03013
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HIN_SALTY | P03013
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HIN_SALTY | P030131hcr 1ijw 1jj8 1jko 1jkp 1jkq 1jkr

(-) Related Entries Specified in the PDB File

1hcr NATIVE WILD-TYPE HIN RECOMBINASE DNA-BINDING DOMAIN BOUND TO UNDERIVATIZED HIXL HALF-SITE
1ijw FORM1 BR18 DERIVATIVE
1jj8 FORM2 I4 DERIVATIVE
1jko FORM1 A10G MUTANT
1jkp FORM1 T11G MUTANT
1jkq FORM1 G9T MUTANT
1jkr FORM1 T11C MUTANT