Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  F6 APTAMER MS2 COAT PROTEIN COMPLEX
 
Authors :  M. A. Convery, S. Rowsell, N. J. Stonehouse, A. D. Ellington, I. Hirao, J. B. Murray, D. S. Peabody, S. E. V. Phillips, P. G. Stockley
Date :  06 Jan 98  (Deposition) - 08 Jul 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,R,S
Biol. Unit 1:  A,B,C,R,S  (60x)
Keywords :  Viral Coat Protein/Rna Complex, Rna Aptamer, Rna Stem Loop, Bacteriophage Ms2, Icosahedral Virus, Virus/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. A. Convery, S. Rowsell, N. J. Stonehouse, A. D. Ellington, I. Hirao, J. B. Murray, D. S. Peabody, S. E. Phillips, P. G. Stockley
Crystal Structure Of An Rna Aptamer-Protein Complex At 2. 8 A Resolution.
Nat. Struct. Biol. V. 5 133 1998
PubMed-ID: 9461079  |  Reference-DOI: 10.1038/NSB0298-133
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (MS2 PROTEIN CAPSID)
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainTG1
    Expression System Taxid562
    Expression System VectorPTACACP'
    Expression System Vector TypePTAC
    GeneCOAT PROTEIN
    Organism ScientificENTEROBACTERIO PHAGE MS2
    Organism Taxid12022
    SynonymMS2 COAT PROTEIN
 
Molecule 2 - RNA (5'- R(*CP*CP*AP*CP*AP*GP*UP*CP*AP*CP*UP*GP*GP*G)-3')
    ChainsR
    EngineeredYES
    Other DetailsFAMILY 6 CONSENSUS SEQUENCE FROM IN VITRO SELECTION
    SynonymF6
    SyntheticYES
 
Molecule 3 - RNA (5'-R(*CP*AP*GP*UP*CP*AP*CP*UP*GP*G)-3')
    ChainsS
    EngineeredYES
    Other DetailsFAMILY 6 CONSENSUS SEQUENCE FROM IN VITRO SELECTION
    SynonymF6
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345
Asymmetric Unit ABCRS
Biological Unit 1 (60x)ABCRS

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 6MSF)

(-) Sites  (0, 0)

(no "Site" information available for 6MSF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 6MSF)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Leu B:77 -Pro B:78

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 6MSF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 6MSF)

(-) Exons   (0, 0)

(no "Exon" information available for 6MSF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:129
                                                                                                                                                                 
               SCOP domains d6msfa_ A: MS2 virus coat protein                                                                                                 SCOP domains
               CATH domains 6msfA00 A:1-129 MS2 Viral Coat Protein                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeee.hhh.eeeee........eeeeeee.....eeeeeeeeeeeeeeeeee..eeeeeeeeeeeeeeeeeee....hhhhhhhhhhhhhh.....hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 6msf A   1 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

Chain B from PDB  Type:PROTEIN  Length:129
                                                                                                                                                                 
               SCOP domains d6msfb_ B: MS2 virus coat protein                                                                                                 SCOP domains
               CATH domains 6msfB00 B:1-129 MS2 Viral Coat Protein                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeee.hhh.eeee.........eeeeeee.....eeeeeeeeeee.............hhh.eeeeeeeeeee....hhhhhhhhhhhhhh.....hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 6msf B   1 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

Chain C from PDB  Type:PROTEIN  Length:129
                                                                                                                                                                 
               SCOP domains d6msfc_ C: MS2 virus coat protein                                                                                                 SCOP domains
               CATH domains 6msfC00 C:1-129 MS2 Viral Coat Protein                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeeeee..eeeeee...hhh..eeeeeeee....eeeeeeeeeeeeeeeeee..eeeeeeeeeeeeeeeeeee....hhhhhhhhhhhhhhh....hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 6msf C   1 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

Chain R from PDB  Type:RNA  Length:14
                                              
                 6msf R   1 CCACAGUCACUGGG  14
                                    10    

Chain S from PDB  Type:RNA  Length:10
                                          
                 6msf S   4 CAGUCACUGG  13
                                    13

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (1, 3)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 6MSF)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 6msf)
 
  Sites
(no "Sites" information available for 6msf)
 
  Cis Peptide Bonds
    Leu B:77 - Pro B:78   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  6msf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAPSD_BPMS2 | P03612
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CAPSD_BPMS2 | P03612
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAPSD_BPMS2 | P036121aq3 1aq4 1bms 1msc 1mst 1mva 1mvb 1u1y 1zdh 1zdi 1zdj 1zdk 1zse 2b2d 2b2e 2b2g 2bny 2bq5 2bs0 2bs1 2bu1 2c4q 2c4y 2c4z 2c50 2c51 2iz8 2iz9 2izm 2izn 2ms2 2vtu 2wbh 4bp7 4zor 5msf 5tc1 7msf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 6MSF)