Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CTPRC2 IN AN AUTOINHIBITED CONFORMATION BOUND TO S-ADENOSYLMETHIONINE
 
Authors :  M. A. Bratkowski, X. Liu
Date :  24 Oct 16  (Deposition) - 14 Jun 17  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.57
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Bratkowski, X. Yang, X. Liu
Polycomb Repressive Complex 2 In An Autoinhibited State.
J. Biol. Chem. 2017
PubMed-ID: 28607149  |  Reference-DOI: 10.1074/JBC.M117.787572

(-) Compounds

Molecule 1 - POLYCOMB PROTEIN EED
    ChainsA
    EngineeredYES
    Expression SystemSACCHAROMYCES CEREVISIAE
    Expression System CommonBAKER'S YEAST
    Expression System Taxid4932
    GeneCTHT_0029920
    Organism ScientificCHAETOMIUM THERMOPHILUM
    Organism Taxid209285
 
Molecule 2 - HISTONE-LYSINE N-METHYLTRANSFERASE EZH2, POLYCOMB PROTEIN SUZ12
    ChainsB
    EngineeredYES
    Expression SystemSACCHAROMYCES CEREVISIAE
    Expression System CommonBAKER'S YEAST
    Expression System Taxid4932
    GeneCTHT_0053230, CTHT_0006210
    Organism ScientificCHAETOMIUM THERMOPHILUM
    Organism Taxid209285

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1SAM1Ligand/IonS-ADENOSYLMETHIONINE
2ZN8Ligand/IonZINC ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS B:727 , CYS B:748 , CYS B:755 , CYS B:760binding site for residue ZN B 8001
2AC2SOFTWARECYS B:736 , CYS B:755 , CYS B:763 , CYS B:784binding site for residue ZN B 8002
3AC3SOFTWARECYS B:727 , CYS B:729 , CYS B:736 , CYS B:746binding site for residue ZN B 8003
4AC4SOFTWARECYS B:685 , HIS B:687 , CYS B:691 , CYS B:697binding site for residue ZN B 8004
5AC5SOFTWARECYS B:691 , CYS B:709 , CYS B:715 , CYS B:720binding site for residue ZN B 8005
6AC6SOFTWARECYS B:685 , CYS B:699 , CYS B:709 , CYS B:713binding site for residue ZN B 8006
7AC7SOFTWARECYS B:508 , CYS B:511 , CYS B:516 , HIS B:518binding site for residue ZN B 8007
8AC8SOFTWARECYS B:570 , CYS B:574 , CYS B:615 , CYS B:625binding site for residue ZN B 8008
9AC9SOFTWARELEU B:804 , CYS B:807 , GLY B:808 , TYR B:809 , LYS B:852 , VAL B:853 , SER B:854 , TYR B:855 , ARG B:877 , ASN B:880 , HIS B:881 , TYR B:918binding site for residue SAM B 8009

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5TQR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5TQR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TQR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TQR)

(-) Exons   (0, 0)

(no "Exon" information available for 5TQR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:470
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh..eeeeeeee...........eeeeee..........eeeeee..eeeeeee..........eeeeeeeee.....eeeeeeee......eeeeeee....eeeee....eeeeee......eeeeeee..eeeeeeeee....eeeee.hhhhh...eeeee........eeeeee.....eeeeee....eeeee............eee....eee.......eeeeeee..eeeeee....eeeeeee..........hhhhh.........eee.........eeeeeeee............eee.......eeeee....eeeeeehhhhhhhhhhhhhhhhhhhhh...eeeee.......hhhhhh.....eeeee.........hhhhhhhhhhhhh...........eeee......eeeeee.....eeeeee...eeeeee.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5tqr A    5 DSAEWELPRLRTSFIFQDDYKSQDLAEFFDVKFYPYSPPGAPPVFAATSKKHAVICRLTQTTDKDANPCEIIQLIRDDGNEANCASCWSKDPITDQPLLCIAGNEGNVKVYNVTEGKLYRTLVGHGGGINDLATSPANPYIIASASDDTTIRIWSLAPEHEKQPCVCILGGEGHSYDLLSVAFHDNGRYVLSAGHDQVINLWALPEFPNEHMEIPIVIYYPHFSSSEIHNNLVDCVAFYGDLILSRACHEDTIVLWRIEGFSSDDPIPGPLDAPTPTDMTKQTRSYFTPSRPAMFTRLAQFHTPDCGVQFFMRFRMYHVPGKHPILAFANAKSKTFFWDLARFGEYARFMADLKEAQQSYNGRVVVVDQGQGISLAQAQQVHGPGVGVVMKPAWLVPKGFSRETLQAWADMYDLSNPVGLIKAHRSLAIDGAFVGRQVGWSPEGEWCVVVGNGNRALIYQRWGKERGLGS  560
                                    14        24||      42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       307       317       327       337       347       357       367       377       387       397       407       490       500       510       520       530       540       550       560
                                               25|                                                                                                                                                                                                                                                                        301|                                                                                                         415|                                                                       
                                                34                                                                                                                                                                                                                                                                         307                                                                                                          489                                                                       

Chain B from PDB  Type:PROTEIN  Length:809
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............................eeeeeeeeee....ee....eeeeee.eee..............ee....ee..............hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhhh.....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh........hhhhhhh....hhhhhh......hhhhhhhhhhhhhhhh............ee.....ee..hhhhhhhhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhh.....hhhhhhhhhh....hhhhhhhhhhh...................ee....ee..hhhhhh...hhhhh.................hhhhhh...............................ee..........hhhhhh............hhhhhhhhhhh...hhhhhee..hhhhhh....eeeee.......eeeee........eeeee..eeehhhhhhhhhhhhh........eeeee....eeee...eehhhhhhee.....eeeeeeee..eeeeeeee..........ee.......hhhhhhhhh............ee......ee............hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5tqr B  195 TEWTVDKIASALSVLAEEVPQNHSRLVNFLLEETEKRAPQPRHLSKTDPFAHMKSKAIDANPEGVPTMDVKFKQHSGEYGKSRNSGRRFQYPVVCIKPDREPVPPYRFHHAEIRKNILALNSQLNFVPHKIQPRSQKIAKRAQAEYAATLAPYLEPWLRKLNIEGCTKSNLIRFMASQPESDDSMTPQQKSNLLDTYSDDMGSPQAVRNASMFTEAWDRVFNDQSKLRRVALRDILMLDKNVEPIFDNKRAKALMQKVIDALGSYTTLGCLICFSHDCEHGEIERDNQKRCFSLEEIGGLMPSLRRKWAAQIEQRQHPPCRNECYRIHGTPPWSENEVGTLEWMFATIGYSQTLRPECFVGAILGRPCWDVHRKLQELDLRLPPVEPRTIPKQKSLPWYDRRKKQLMSDWADATITHEHAVRELFAPCHHDGPCTAANGCPCASAGTHPVLCERFCLCTAEECPLKFTGCACHSSGKTCLQRQREGRPCICVQLNRECDPTLCKGCGARERADPENAYDEVLHSTGCQNVALQRGAAKAVVLGKSQLEACGYGLFAAEDIEEGEFVIEYTGELISHDEGVRREHRRGDEENKVSYLFTLLEQEGIWVDAAIYGNLSRYINHATDGNIMPKIMYVNHEWRIKFTAIKDIKAGEELFFNYGDNFPNLTKKLVERNRPLLVPKTTQPLFDPLSKVQLLPGQPLPQHPIDDSWLLLKHRDNLQDFIDLRPEEKEFLQEWDAFILRRHISSEQYLPRYFLRFVREKADWLVSKRSRGEEFSKLVATLLARRVLPERVVIEATQVLNDARGRLRE 2684
                                   204       214       224       234       244       254||     267       277       287       297       307       317       357       367       377       387       397       407       417       427       437       447       457       467       477 ||    498       508       518       528       538       548     ||570       580|      597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       850       860       870       880       890       900       910       920       930  ||  2555      2565      2575      2585      2595      2605      2615      2625      2635      2645      2655      2665      2675         
                                                                                      255|                                                                326|                                                                                                                       479|                                                            554|          580|                                                                                                                                                                                                                                                              845|                                                                                 933|                                                                                                                                       
                                                                                       259                                                                 357                                                                                                                        491                                                             567           588                                                                                                                                                                                                                                                               849                                                                                 2549                                                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TQR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TQR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TQR)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5TQR)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SAM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5tqr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5tqr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G0RYC6_CHATD | G0RYC6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  G0S8H7_CHATD | G0S8H7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  G0SDW4_CHATD | G0SDW4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  G0RYC6_CHATD | G0RYC6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G0S8H7_CHATD | G0S8H7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G0SDW4_CHATD | G0SDW4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        G0RYC6_CHATD | G0RYC65bjs 5vk3
        G0S8H7_CHATD | G0S8H75bjs 5vk3
        G0SDW4_CHATD | G0SDW45bjs 5vk3
UniProtKB/TrEMBL
        G0RYC6_CHATD | G0RYC65kjh 5kji 5kkl 5m5g
        G0S8H7_CHATD | G0S8H75kjh 5kji 5kkl 5m5g
        G0SDW4_CHATD | G0SDW45kjh 5kji 5kkl 5m5g

(-) Related Entries Specified in the PDB File

5bjs APO FORM OF THE COMPLEX.
5vk3 APO FORM OF THE COMPLEX WITH E840A AND K852D MUTATIONS IN EZH2 (CHAIN B).