Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  GLYCOSIDE HYDROLASE BACINT_00347
 
Authors :  J. Munoz-Munoz, A. Cartmell, N. Terrapon, B. Henrissat, H. J. Gilbert
Date :  13 Jan 17  (Deposition) - 26 Apr 17  (Release) - 17 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Rhamnosidase, Bacteroides, Beta-Propeller, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Munoz-Munoz, A. Cartmell, N. Terrapon, B. Henrissat, H. J. Gilbert
Unusual Active Site Location And Catalytic Apparatus In A Glycoside Hydrolase Family.
Proc. Natl. Acad. Sci. V. 114 4936 2017 U. S. A.
PubMed-ID: 28396425  |  Reference-DOI: 10.1073/PNAS.1701130114

(-) Compounds

Molecule 1 - BACINT_00347
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: BACINT_00347
    Organism Scientific: BACTEROIDES INTESTINALIS DSM 17393
    Organism Taxid: 471870

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
11PE2Ligand/IonPENTAETHYLENE GLYCOL
2EDO2Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:204 , VAL A:218 , LEU A:231 , LEU A:272 , ILE A:273 , THR A:276 , THR A:290 , HOH A:605binding site for residue EDO A 501
2AC2SOFTWAREASN A:41 , THR A:42 , THR A:43 , ARG A:46 , SER A:49 , TRP A:387 , GLU A:388 , PRO A:389 , SER A:390 , PHE A:405binding site for residue EDO A 502
3AC3SOFTWAREASP A:238 , ASN A:239 , CYS A:264 , ARG A:265 , PRO A:267 , ASN A:314 , HOH A:741 , HOH A:776 , HOH A:782binding site for residue 1PE A 503
4AC4SOFTWARESER A:39 , THR A:42 , THR A:43 , PHE A:45 , TYR A:148 , GLN A:275 , ARG A:338 , GLU A:388 , GLN A:411 , HOH A:613binding site for residue 1PE A 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5MUM)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asn A:47 -Asn A:48
2Leu A:253 -Pro A:254

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MUM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MUM)

(-) Exons   (0, 0)

(no "Exon" information available for 5MUM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:394
                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee...............eeee..eeeeeee....eeeeeeee......eeeeeeee.........eeeee.....eeeee........eee......................eeeeeeee.hhh.eeeeeee......eeeeeeee....eeeeee..........eeeeeeee.....eeeeeeee...hhh.eeeeeeeee........................eeee............eeee.....eeeeeee........eeeeeee....eeeee..................eeeee..eeeeee.hhhhh...eeeee........eeee.............hhhhhhhhh..eeeee.........eeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mum A  26 SRLVEVGNGYSQTSVNTTVFRNNSLVTQGDEQYISYYDGDGYLVLGKRKLNSDQWTLQRTQYKGNVKDAHNIISMMLDGDGYLHLSFDHHGHKLNYCRSTAPYTLELGDKEPMTGVDEGNVTYPEFYPLNGGDLLFVYRSGSSGRGNLVMNRYSVKEKKWYRVQDVLIDGEDQRNAYWQLYVDEQGTIHLSWVWRETWHVETNHDLCYARSYDNGVTWYKANGKKYDLPIRYNNAEYACRIPQNSELINQTSMSADASGNPYIATYWRDPDSDVPQYRIVWHDGQMWQNRQVSDRHTPFSLKMIPIARPRIVVDGGEIFYIFRDEERGSRVSMAHAQAVGTGKWTITDLTDFAVDAWEPSHDTELWKQKRRLHLFVQHTKQVEFAPQPVYVLEV 430
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325 ||    340       350       360       370       380       390       400       410||     426    
                                                                                                                                                                                                                                                                                                                                       327|                                                                           411|            
                                                                                                                                                                                                                                                                                                                                        333                                                                            418
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MUM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MUM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MUM)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5MUM)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1PE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:47 - Asn A:48   [ RasMol ]  
    Leu A:253 - Pro A:254   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mum
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B3C613_9BACE | B3C613
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B3C613_9BACE | B3C613
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5MUM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MUM)