Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  N-TERMINAL DOMAIN OF MOUSE SHISA 3
 
Authors :  B. Lohkamp, J. R. M. Ojala
Date :  06 Oct 16  (Deposition) - 05 Apr 17  (Release) - 12 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.39
Chains :  Asym./Biol. Unit :  A
Keywords :  Single-Pass Transmembrane Protein, Tumor Suppressor Gene, Wnt- Signaling Pathway, Disulfide, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. J. Mccoy, R. D. Oeffner, A. G. Wrobel, J. R. Ojala, K. Tryggvason, B. Lohkamp, R. J. Read
Ab Initio Solution Of Macromolecular Crystal Structures Without Direct Methods.
Proc. Natl. Acad. Sci. V. 114 3637 2017 U. S. A.
PubMed-ID: 28325875  |  Reference-DOI: 10.1073/PNAS.1701640114
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN SHISA-3 HOMOLOG
    ChainsA
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System PlasmidPVL1393
    Expression System Taxid7111
    Expression System VariantH5
    FragmentUNP RESIDUES 22-95
    GeneSHISA3
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    Other DetailsN-TERMINAL DOMAIN WITH STREP TAG

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 11)

Asymmetric/Biological Unit (6, 11)
No.NameCountTypeFull Name
1EDO3Ligand/Ion1,2-ETHANEDIOL
2GOL3Ligand/IonGLYCEROL
3MES1Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
4PCA1Mod. Amino AcidPYROGLUTAMIC ACID
5PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
6SO42Ligand/IonSULFATE ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:29 , GLY A:30 , ARG A:82 , MES A:209 , HOH A:305 , HOH A:360binding site for residue SO4 A 201
02AC2SOFTWAREARG A:72 , GLU A:74 , GLN A:75 , GLY A:76 , HOH A:310 , HOH A:343 , HOH A:358binding site for residue SO4 A 202
03AC3SOFTWAREGLY A:25 , GLN A:43 , HOH A:362 , HOH A:373binding site for residue GOL A 203
04AC4SOFTWAREGLY A:30 , ASP A:81 , ARG A:82 , HOH A:305 , HOH A:360binding site for residue GOL A 204
05AC5SOFTWAREGLU A:26 , TYR A:27 , HIS A:29 , ARG A:72 , HOH A:373 , HOH A:375binding site for residue GOL A 205
06AC6SOFTWAREGLU A:46 , ASP A:47 , PHE A:48 , ASP A:49 , EDO A:207binding site for residue EDO A 206
07AC7SOFTWAREEDO A:206 , HOH A:311 , HOH A:313 , HOH A:340 , HOH A:345binding site for residue EDO A 207
08AC8SOFTWAREPRO A:24 , GLY A:25 , GLN A:43 , CYS A:44 , PRO A:45 , HOH A:328 , HOH A:338 , HOH A:362 , HOH A:388binding site for residue EDO A 208
09AC9SOFTWARETYR A:27 , HIS A:29 , GLY A:30 , TYR A:38 , GLU A:40 , GLY A:41 , ARG A:82 , SO4 A:201 , HOH A:305 , HOH A:339 , HOH A:347 , HOH A:360binding site for residue MES A 209
10AD1SOFTWAREGLY A:58 , ASP A:70 , ALA A:71 , HOH A:315binding site for residue PEG A 210

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:28 -A:56
2A:44 -A:65
3A:57 -A:66
4A:60 -A:78

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Cys A:44 -Pro A:45

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5M0W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5M0W)

(-) Exons   (0, 0)

(no "Exon" information available for 5M0W)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:63
                                                                                              
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee..ee.....ee..ee...........eeeee..eeeee.hhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------- Transcript
                  5m0w A 22 xQPGEYCHGWVDAQGNYHEGFQCPEDFDTQDATICCGSCALRYCCAAADARLEQGGCTNDRGE 84
                            |       31        41        51        61        71        81   
                            |                                                              
                           22-PCA                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5M0W)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5M0W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5M0W)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PCA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Cys A:44 - Pro A:45   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5m0w
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SHSA3_MOUSE | Q3UPR0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SHSA3_MOUSE | Q3UPR0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5M0W)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5M0W)