Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MOUSE POFUT1 IN COMPLEX WITH O-GLUCOSYLATED EGF(+) AND GDP
 
Authors :  Z. Li, J. M. Rini
Date :  21 Jul 16  (Deposition) - 17 May 17  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Glycosyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Li, K. Han, J. E. Pak, M. Satkunarajah, D. Zhou, J. M. Rini
Recognition Of Egf-Like Domains By The Notch-Modifying O-Fucosyltransferase Pofut1.
Nat. Chem. Biol. V. 13 757 2017
PubMed-ID: 28530709  |  Reference-DOI: 10.1038/NCHEMBIO.2381

(-) Compounds

Molecule 1 - GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 1
    Chains: A
    EC Number: 2.4.1.221
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Plasmid: PB-T-PAF
    Expression System Taxid: 9606
    Expression System Vector Type: PLASMID
    Gene: POFUT1
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: PEPTIDE-O-FUCOSYLTRANSFERASE 1,O-FUCT-1
 
Molecule 2 - EGF(+)
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric/Biological Unit (3, 4)
No.NameCountTypeFull Name
1BGC1Ligand/IonBETA-D-GLUCOSE
2GDP1Ligand/IonGUANOSINE-5'-DIPHOSPHATE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:48 , PHE A:49 , GLY A:50 , ASN A:51 , HIS A:243 , ARG A:245 , TRP A:250 , ALA A:314 , THR A:315 , ASP A:316 , PRO A:339 , ALA A:342 , ASP A:345 , SER A:361 , SER A:362 , PHE A:363 , HOH A:518 , HOH A:523 , HOH A:563 , HOH A:614 , HOH A:697binding site for residue GDP A 403
2AC2SOFTWAREASP A:35 , ALA A:37 , ASN A:67 , ARG A:106 , GLN A:351 , ASP A:353 , ARG A:376 , HOH A:524 , HOH A:573 , HOH A:609 , HOH A:659binding site for Mono-Saccharide NAG A 401 bound to ASN A 67
3AC3SOFTWARELEU A:88 , HIS A:89 , VAL A:90 , SER A:91 , LYS A:94 , ASN A:165 , HOH A:529 , HOH A:596 , HOH A:632binding site for Mono-Saccharide NAG A 402 bound to ASN A 165
4AC4SOFTWAREVAL A:134 , ARG A:138 , GLU B:4 , SER B:7 , TYR B:23binding site for Mono-Saccharide BGC B 1001 bound to SER B 7

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:43 -A:45
2A:131 -A:145
3A:254 -A:288
4A:272 -A:359
5B:5 -B:16
6B:10 -B:25
7B:27 -B:36

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Pro A:83 -Pro A:84
2Asn A:151 -Pro A:152
3Phe A:204 -Pro A:205
4Arg A:237 -Pro A:238

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KY7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KY7)

(-) Exons   (0, 0)

(no "Exon" information available for 5KY7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.....hhhhhhhhhhhhhhhhhhhh.eeee..eee..........eeehhhhhh.hhhhhhh..eeehhhhhhhhhhhhhhhhh.eeeeehhhhh.........hhhhhhhh......eeeee.....hhhhhhhhhhhh......eeee.........hhhhhhhhhhh..hhhhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhh.........hhhhhh.........hhhhhh.hhhhhhhhhhhhhhhhh..eeeeee....hhhhhhhhhh...eee.....hhhhhhhhhhh..eeee...hhhhhhhhhhhhhh...eee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ky7 A  33 SWDLAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVVSLEDFMENLAPSHWPPEKRVAYCFEVAAQRTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYKEQWTQRFPAKEHPVLALPGAPAQFPVLEEHRELQKYMVWSDEMVRTGEALISAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTATPLTMTMCLPDLKEIQRAVTLWVRALNARSVYIATDSESYVSEIQQLFKDKVRVVSLKPEVAQIDLYILGQADHFIGNCVSSFTAFVKRERDLHGRQSSFFGMD 384
                                    42        52        62        72        82        92       102       112       122       132     ||147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       
                                                                                                                                   138|                                                                                                                                                                                                                                                
                                                                                                                                    144                                                                                                                                                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:38
                                                                      
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
               Pfam domains -------------------------------------- Pfam domains
         Sec.struct. author hhhhhh......eeee....eeee....ee.....ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------- PROSITE
                 Transcript -------------------------------------- Transcript
                 5ky7 B   3 DECASNPCQNGGTCVNTVGSYTCLCPPGFTGPNCEDDI  40
                                    12        22        32
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KY7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KY7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KY7)

(-) Gene Ontology  (16, 16)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BGC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:237 - Pro A:238   [ RasMol ]  
    Asn A:151 - Pro A:152   [ RasMol ]  
    Phe A:204 - Pro A:205   [ RasMol ]  
    Pro A:83 - Pro A:84   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ky7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OFUT1_MOUSE | Q91ZW2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.1.221
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  OFUT1_MOUSE | Q91ZW2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        OFUT1_MOUSE | Q91ZW2: 5kxh 5kxq 5ky0 5ky2 5ky3 5ky4 5ky5 5ky8 5ky9

(-) Related Entries Specified in the PDB File

5kxh 5kxq 5ky0 5ky2 5ky3 5ky4 5ky5 5ky8 5ky9