Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRYPANOSOME BRUCEI HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANFERASE IN COMPLEX WITH A 9-[7-(PHOSPHONOHEPTYL]GUANINE
 
Authors :  D. Teran, L. Guddat
Date :  09 May 16  (Deposition) - 09 Nov 16  (Release) - 09 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Inhibitor, Complex, Dimer, Enzyme, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Teran, D. Hockova, M. Cesnek, A. Zikova, L. Naesens, D. T. Keough, L. W. Guddat
Crystal Structures And Inhibition Of Trypanosoma Brucei Hypoxanthine-Guanine Phosphoribosyltransferase.
Sci Rep V. 6 35894 2016
PubMed-ID: 27786284  |  Reference-DOI: 10.1038/SREP35894

(-) Compounds

Molecule 1 - HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANFERASE
    Chains: A, B
    EC Number: 2.4.2.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: HGPRT
    Organism Scientific: TRYPANOSOMA BRUCEI BRUCEI
    Organism Taxid: 5702
    Synonym: HGPRTASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 11)

Asymmetric/Biological Unit (5, 11)
No.NameCountTypeFull Name
16MS2Ligand/Ion[6-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)HEXYL]PHOSPHONIC ACID
2GOL3Ligand/IonGLYCEROL
3MG2Ligand/IonMAGNESIUM ION
4PEG2Ligand/IonDI(HYDROXYETHYL)ETHER
5SO42Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELEU A:53 , GLU A:113 , ILE A:115 , ASP A:117 , THR A:118 , ALA A:119 , LEU A:120 , THR A:121 , LEU A:122 , LYS A:145 , VAL A:165 , PHE A:166 , VAL A:167 , LEU A:172 , ASP A:173 , HOH A:401 , HOH A:408 , HOH A:465 , HOH A:496binding site for residue 6MS A 301
02AC2SOFTWAREGLU A:17 , HIS A:21 , ARG A:182 , HOH A:425 , HIS B:21 , ASP B:62 , ARG B:65 , ILE B:66 , PEG B:302binding site for residue PEG A 302
03AC3SOFTWAREARG A:123 , PHE A:153 , THR A:154 , HOH A:410 , HOH A:431binding site for residue GOL A 303
04AC4SOFTWARETYR A:178 , GLU A:180 , VAL A:181 , HOH A:409 , HOH A:415 , HOH A:435 , HOH A:474 , PRO B:42 , GLY B:68binding site for residue GOL A 304
05AC5SOFTWAREGLN A:176 , SO4 A:306binding site for residue MG A 305
06AC6SOFTWARELYS A:54 , GLY A:55 , ARG A:179 , MG A:305 , HOH A:418binding site for residue SO4 A 306
07AC7SOFTWARELEU B:53 , GLU B:113 , ILE B:115 , ASP B:117 , THR B:118 , ALA B:119 , LEU B:120 , THR B:121 , LEU B:122 , LYS B:145 , VAL B:165 , PHE B:166 , VAL B:167 , ASP B:173 , HOH B:401 , HOH B:422 , HOH B:444 , HOH B:520binding site for residue 6MS B 301
08AC8SOFTWAREHIS A:21 , ASP A:62 , ARG A:65 , ILE A:66 , PEG A:302 , GLU B:17 , HIS B:21 , ARG B:182 , HOH B:411binding site for residue PEG B 302
09AC9SOFTWAREPRO A:42 , PRO A:73 , TYR B:178 , GLU B:180 , VAL B:181 , HOH B:407 , HOH B:425 , HOH B:524binding site for residue GOL B 303
10AD1SOFTWAREGLN B:176 , ARG B:179 , SO4 B:305binding site for residue MG B 304
11AD2SOFTWARELYS B:54 , GLY B:55 , ARG B:179 , MG B:304 , HOH B:414binding site for residue SO4 B 305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JSQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JSQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JSQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JSQ)

(-) Exons   (0, 0)

(no "Exon" information available for 5JSQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeehhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee...hhhhhhhhhhhhhhh...eeeeee......eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.hhhh.......eeeee.....ee...............eeeehhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jsq A   5 CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL 199
                                    14        24        34        44        54        64        74     ||106       116       126       136       146       156       166       176       186       196   
                                                                                                      80|                                                                                                
                                                                                                      103                                                                                                


Chain B from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeehhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee...hhhhhhhhhhhhhhh...eeeeee.........eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.hhhh.......eeeee.....ee...............eeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jsq B   5 CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRGLCDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWG 196
                                    14        24        34        44        54        64        74     ||103       113       123       133       143       153       163       173       183       193   
                                                                                                      80|                                                                                                
                                                                                                      100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JSQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JSQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JSQ)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6MS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jsq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jsq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HPRT_TRYBB | Q07010
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HPRT_TRYBB | Q07010
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HPRT_TRYBB | Q07010: 5jv5 5k51 5kam 5kap

(-) Related Entries Specified in the PDB File

5jv5 5k51 5kam 5kap