Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF REB1-TER COMPLEX
 
Authors :  R. Jaiswal, M. Choudhury, S. Zaman, S. Singh, V. Santosh, D. Bastia, C. R. Escalante
Date :  24 Nov 15  (Deposition) - 13 Apr 16  (Release) - 04 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,C,D  (1x)
Biol. Unit 2:  B,E,F  (1x)
Keywords :  Protein-Dna Complex, Transcription Termination, Replication Termination, Dna Binding Protein-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Jaiswal, M. Choudhury, S. Zaman, S. Singh, V. Santosh, D. Bastia, C. R. Escalante
Functional Architecture Of The Reb1-Ter Complex Of Schizosaccharomyces Pombe.
Proc. Natl. Acad. Sci. Usa V. 113 E2267 2016
PubMed-ID: 27035982  |  Reference-DOI: 10.1073/PNAS.1525465113
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA-BINDING PROTEIN REB1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)PLYSS
    Expression System Taxid: 469008
    Fragment: UNP RESIDUES 146-504
    Gene: REB1, SPBC1198.11C, SPBC660.01C
    Organism Common: FISSION YEAST
    Organism Scientific: SCHIZOSACCHAROMYCES POMBE
    Organism Taxid: 284812
    Strain: 972 / ATCC 24843
 
Molecule 2 - DNA (26-MER)
    Chains: C, E
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES
 
Molecule 3 - DNA (26-MER)
    Chains: D, F
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): A CD  
Biological Unit 2 (1x):  B  EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5EYB)

(-) Sites  (0, 0)

(no "Site" information available for 5EYB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EYB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EYB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EYB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EYB)

(-) Exons   (0, 0)

(no "Exon" information available for 5EYB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:340
                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh....hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.hhhhhhhhh..hhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5eyb A 154 ARWTAEHWDYLERRMQNFCQTYSLDHTQVADSLHEKRLHGPLSSLVKLLVQEMPSFTRRTILRHLRALYNIPGYEKYSRKNSSGRGDFGVQETAIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIRMFYSNLYKKLSHRDAKSIYHHVRRAYNPFEDRCVWSKEEDEELRKNVVEHGKCWTKIGRKMARMPNDCRDRWRDVVRFGDKLKRNAWSLEEETQLLQIVAELSDINWTLVAQMLGTRTRLQCRYKFQQLTKAASKFELQENVWLLERIYDSLLNNGGKIHWENIVKEANGRWTRDQMLFQFINLKKMIPSYDNLPLLEATKSAIDDFKVVLS 500
                                   163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383|      400       410       420       430       440       450       460       470       480       490       500
                                                                                                                                                                                                                                                               383|                                                                                                             
                                                                                                                                                                                                                                                                391                                                                                                             


Chain B from PDB  Type:PROTEIN  Length:337
                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhh...hhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhhhhhhhhhh.....hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhh............hhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5eyb B 155 RWTAEHWDYLERRMQNFCQTYSLDHTQVADSLHEKRLHGPLSSLVKLLVQEMPSFTRRTILRHLRALYNIPGYEKYSRKNSSGRGDFGVQETAIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIRMFYSNLYKKLSHRDAKSIYHHVRRAYNPFEDRCVWSKEEDEELRKNVVEHGKCWTKIGRKMARMPNDCRDRWRDVVRFGDKLKRNAWSLEEETQLLQIVAEDINWTLVAQMLGTRTRLQCRYKFQQLTKAASKFELQENVWLLERIYDSLLNNGGKIHWENIVKEANGRWTRDQMLFQFINLKKMIPSYDNLPLLEATKSAIDDFKVVLS 500
                                   164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       393       403       413       423       433       443       453       463       473       483       493       
                                                                                                                                                                                                                                                             382|                                                                                                            
                                                                                                                                                                                                                                                              392                                                                                                            


Chain C from PDB  Type:DNA  Length:26
                                                          
                 5eyb C   1 GTAAAAGGTAAGGGTAATGCACTTTT  26
                                    10        20      


Chain D from PDB  Type:DNA  Length:26
                                                          
                 5eyb D   1 CAAAAGTGCATTACCCTTACCTTTTA  26
                                    10        20      


Chain E from PDB  Type:DNA  Length:26
                                                          
                 5eyb E   1 GTAAAAGGTAAGGGTAATGCACTTTT  26
                                    10        20      


Chain F from PDB  Type:DNA  Length:26
                                                          
                 5eyb F   1 CAAAAGTGCATTACCCTTACCTTTTA  26
                                    10        20
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EYB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EYB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EYB)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5eyb)
 
  Sites
(no "Sites" information available for 5eyb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5eyb)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5eyb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  REB1_SCHPO | Q9P6H9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  REB1_SCHPO | Q9P6H9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5EYB)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5EYB)