Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE ACTIVE FORM OF HUMAN ORIGIN RECOGNITION COMPLEX AND ITS ATPASE MOTOR MODULE
 
Authors :  A. Tocilj, K. On, Z. Yuan, J. Sun, E. Elkayam, H. Li, B. Stillman, L. Joshu
Date :  18 Jan 17  (Deposition) - 08 Feb 17  (Release) - 08 Feb 17  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  18.00
Chains :  Asym./Biol. Unit :  A,B,C,D,E
Keywords :  Orc, Replication, Atpase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Tocilj, K. F. On, Z. Yuan, J. Sun, E. Elkayam, H. Li, B. Stillman, L. Joshua-Tor
Structure Of The Active Form Of Human Origin Recognition Complex And Its Atpase Motor Module.
Elife V. 6 2017
PubMed-ID: 28112645  |  Reference-DOI: 10.7554/ELIFE.20818

(-) Compounds

Molecule 1 - ORIGIN RECOGNITION COMPLEX SUBUNIT 1
    ChainsA
    EngineeredYES
    Expression SystemSPODOPTERA AFF. FRUGIPERDA 2 RZ-2014
    Expression System CommonFALL ARMYWORM
    Expression System Taxid1491790
    FragmentUNP RESIDUES 471-861
    GeneORC1, ORC1L, PARC1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsSTREP-STREP-SUMO-TAGGED
    SynonymREPLICATION CONTROL PROTEIN 1
 
Molecule 2 - ORIGIN RECOGNITION COMPLEX SUBUNIT 2
    ChainsB
    EngineeredYES
    Expression SystemSPODOPTERA AFF. FRUGIPERDA 2 RZ-2014
    Expression System CommonFALL ARMYWORM
    Expression System Taxid1491790
    GeneORC2, ORC2L
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 3 - ORIGIN RECOGNITION COMPLEX SUBUNIT 3
    ChainsC
    EngineeredYES
    Expression SystemSPODOPTERA AFF. FRUGIPERDA 2 RZ-2014
    Expression System CommonFALL ARMYWORM
    Expression System Taxid1491790
    GeneORC3, LATHEO, ORC3L
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymORIGIN RECOGNITION COMPLEX SUBUNIT LATHEO
 
Molecule 4 - ORIGIN RECOGNITION COMPLEX SUBUNIT 4
    ChainsD
    EngineeredYES
    Expression SystemSPODOPTERA AFF. FRUGIPERDA 2 RZ-2014
    Expression System CommonFALL ARMYWORM
    Expression System Taxid1491790
    GeneORC4, ORC4L
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 5 - ORIGIN RECOGNITION COMPLEX SUBUNIT 5
    ChainsE
    EngineeredYES
    Expression SystemSPODOPTERA AFF. FRUGIPERDA 2 RZ-2014
    Expression System CommonFALL ARMYWORM
    Expression System Taxid1491790
    GeneORC5, ORC5L
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12345
Asymmetric/Biological Unit ABCDE

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1ATP3Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2MG2Ligand/IonMAGNESIUM ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:500 , GLU A:502 , CYS A:506 , PRO A:536 , GLY A:539 , LYS A:540 , THR A:541 , ALA A:542 , GLU A:621 , ASN A:654 , TYR A:681 , ILE A:689 , ALA A:719 , ARG A:720 , LEU A:723 , MG A:902 , ARG D:209binding site for residue ATP A 901
2AC2SOFTWARETHR A:541 , ASP A:620 , GLU A:621 , ATP A:901binding site for residue MG A 902
3AC3SOFTWAREGLN D:31 , ASN D:36 , PHE D:38 , VAL D:40 , PRO D:68 , ARG D:69 , GLY D:70 , SER D:71 , GLY D:72 , LYS D:73 , THR D:74 , MET D:75 , LEU D:276 , ARG D:277 , HIS D:280 , MG D:902 , ARG E:143binding site for residue ATP D 901
4AC4SOFTWARETHR D:74 , ASP D:159 , ATP D:901 , ARG E:143binding site for residue MG D 902
5AC5SOFTWARELEU E:9 , HIS E:38 , THR E:39 , ALA E:40 , SER E:41 , GLY E:42 , LYS E:43 , THR E:44 , TYR E:45 , ASP E:125 , GLU E:159 , TYR E:182 , ILE E:190 , LEU E:222 , ARG E:226binding site for residue ATP E 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5UJM)

(-) Cis Peptide Bonds  (10, 10)

Asymmetric/Biological Unit
No.Residues
1Ser A:503 -Leu A:504
2Pro A:562 -Phe A:563
3Ser B:397 -Gln B:398
4Gln B:398 -Met B:399
5Pro B:453 -Tyr B:454
6Gln C:209 -Trp C:210
7Ser C:489 -Thr C:490
8Val D:123 -Val D:124
9Leu E:54 -Glu E:55
10Ser E:412 -Leu E:413

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5UJM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5UJM)

(-) Exons   (0, 0)

(no "Exon" information available for 5UJM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:337
                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh.........hhhhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhh.......eeeee.......hhhhhhhhhhh.....hhhhhhhhhhhhh...eeeee.hhhhh...hhhhhhhhhhhhh.....eeeee....hhhhh.eeee...hhhhhhhhhhhh......hhhhhhhh.....hhhhhhhhhhhhhhhhh.hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eee.hhhhhhh.eeee..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ujm A 490 EARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTTVLLVDELDILWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERTRMCFQPYTYSQLQQILRSRLKHLKIQLVARKVAALSGDARRCLDICRRATEICEFVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE 861
                                   499       509       519       529       539       549       559       569       579       589       599      |616       626       636       646       656    || 678       688       698|      714       724       734||     754       764       774       784       794       804       814       824       834       844       854       
                                                                                                                                              606|                                            661|                     698|                           735|                                                                                                                   
                                                                                                                                               614                                             674                      705                            746                                                                                                                   

Chain B from PDB  Type:PROTEIN  Length:287
                                                                                                                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh.eeeee....hhhhhhhhhhh......eeeee......hhhhhhhhhhhh.........hhhhhhhhhhhhhh......eeeeee..........hhhhhhhhhhhh..eeeeeee...hhhhhhhhhhhhhh.eeee......................hhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh....hhhhhhhhhhhhhhh...eeee.....eeee...hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ujm B 284 SAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEE 574
                                   293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463  ||   477       487       497       507       517       527       537       547       557       567       
                                                                                                                                                                                                                466|                                                                                                       
                                                                                                                                                                                                                 471                                                                                                       

Chain C from PDB  Type:PROTEIN  Length:553
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ee......hhhhhhhhhhhhhhhhhh.....eee.......hhhhhhhhhhhhhhh.hhhhh.hhhhh..hhhhhhh..............eee......hhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhhhhhh..ee....hhhhhhhhhhhhh........eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh....hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh.hhhhhhhhhhhh....................ee.hhhhhhhhh..hhhhhhhhhhhh.hhhhhhhhhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee.....ee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ujm C  41 KLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDAKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPDICIAYKLHLECSRLINLVDWSEAFATVVIIHARFIRAVSELELLGFIKPTKQKTDHVARLTW 709
                                    50        60        70        80  ||   103       113       123       133       143       153       163||     196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506|      557       567       577       587       597       628       638       648       676       686       696       706   
                                                                     83|                                                                164|                                                                                                                                                                                                                                                                                                                           506|                                                       606|                          657|                                 
                                                                      97                                                                 188                                                                                                                                                                                                                                                                                                                            548                                                        628                           676                                 

Chain D from PDB  Type:PROTEIN  Length:394
                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh....eeeeee.....hhhhhhhhhhhhhhhhhhhhhhheeeeee.....hhhhhhhhhhhhh............hhhhhhhhhhh...eeeeeehhhhhh....hhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhh....eee....hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh..eee.....eee..hhhhhhhhhhhh...hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ujm D  17 LSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEACPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMEYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSS 432
                                    26        36        46        56        66        76        86        96       106       116       126       136     ||155       165       175       185       195       205       215       225       235   ||  249       259       269       279       289       299       309       319       329       339       349       359       369       379       398       408       418       428    
                                                                                                                                                       142|                                                                                    239|                                                                                                                                             388|                                  
                                                                                                                                                        152                                                                                     244                                                                                                                                              398                                  

Chain E from PDB  Type:PROTEIN  Length:357
                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh........eeeee.hhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhh......hhhhhhhhhhh..........eeeeee.hhhhhhh..hhhhhhhhhhhhhh..eeeeeee..hhhhh.........eeee....hhhhhhhhhh.......hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.......eehhhhhhhhhhhhhh.....hhhhhhhhhhhhhh..eee...........eee...hhhhhhhhhhhh.hhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ujm E   8 VLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLRLLLEQILNKLNTCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGERKLWRNIEPHLKKAMQTVHVELPYYSKFILIAAYLASYNPARTDKRFFNHLLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYLYD 433
                                    17        27        37        47        57        67        77   ||  100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   ||  256       266 ||    306       316       326 ||    356       366       376       386       396       406       416       426       
                                                                                                    81|                                                                                                                                                  244|              268|                          328|                                                                                    
                                                                                                     95                                                                                                                                                   251               299                           349                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5UJM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5UJM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5UJM)

(-) Gene Ontology  (30, 77)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln B:398 - Met B:399   [ RasMol ]  
    Gln C:209 - Trp C:210   [ RasMol ]  
    Leu E:54 - Glu E:55   [ RasMol ]  
    Pro A:562 - Phe A:563   [ RasMol ]  
    Pro B:453 - Tyr B:454   [ RasMol ]  
    Ser A:503 - Leu A:504   [ RasMol ]  
    Ser B:397 - Gln B:398   [ RasMol ]  
    Ser C:489 - Thr C:490   [ RasMol ]  
    Ser E:412 - Leu E:413   [ RasMol ]  
    Val D:123 - Val D:124   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ujm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ORC1_HUMAN | Q13415
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ORC2_HUMAN | Q13416
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ORC3_HUMAN | Q9UBD5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ORC4_HUMAN | O43929
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ORC5_HUMAN | O43913
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ORC1_HUMAN | Q13415
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ORC2_HUMAN | Q13416
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ORC3_HUMAN | Q9UBD5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ORC4_HUMAN | O43929
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ORC5_HUMAN | O43913
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ORC1_HUMAN | Q134155uj7
        ORC2_HUMAN | Q134165c8h 5uj8
        ORC3_HUMAN | Q9UBD55uj8
        ORC4_HUMAN | O439295uj7
        ORC5_HUMAN | O439135uj7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5UJM)