Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ADAPTOR PROTEIN 2 ASSOCIATED KINASE (AAK1) IN COMPLEX WITH BIBF 1120
 
Authors :  R. M. Counago, J. M. Elkins, C. Bountra, P. Arruda, A. M. Edwards, O. Gile Structural Genomics Consortium (Sgc)
Date :  20 Sep 16  (Deposition) - 02 Nov 16  (Release) - 02 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Transferase, Protein Kinase Domain, Structural Genomics, Structural Genomics Consortium, Sgc, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. M. Counago, J. M. Elkins, C. H. Arrowsmith, C. Bountra, P. Arruda, A. M. Edwards, O. Gileadi
Crystal Structure Of Adaptor Protein 2 Associated Kinase (Aak1) In Complex With Bibf 1120
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - AP2-ASSOCIATED PROTEIN KINASE 1
    ChainsA
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPNIC-CTH0
    Expression System StrainDE3
    Expression System Taxid562
    FragmentUNP RESIDUES 27-365
    GeneAAK1, KIAA1048
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymADAPTOR-ASSOCIATED KINASE 1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 10)

Asymmetric/Biological Unit (3, 10)
No.NameCountTypeFull Name
1GOL8Ligand/IonGLYCEROL
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3XIN1Ligand/IonMETHYL (3Z)-3-{[(4-{METHYL[(4-METHYLPIPERAZIN-1-YL)ACETYL]AMINO}PHENYL)AMINO](PHENYL)METHYLIDENE}-2-OXO-2,3-DIHYDRO-1H-INDOLE-6-CARBOXYLATE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREMET A:26 , SER A:32 , ILE A:35 , ASP A:49 , GLU A:50 , LEU A:52 , ALA A:53 , ALA A:72 , MET A:94 , VAL A:104 , MET A:126 , ASP A:127 , PHE A:128 , CYS A:129 , ARG A:130 , GLY A:132 , GLN A:133 , ASN A:136 , LEU A:183 , ASP A:194 , HOH A:645 , HOH A:668binding site for residue XIN A 401
02AC2SOFTWARELYS A:242 , ASP A:299 , LYS A:300 , ARG A:301 , GLN A:306 , SER A:327 , HOH A:532 , HOH A:553binding site for residue PEG A 402
03AC3SOFTWARELEU A:142 , GLN A:143 , GLY A:145 , CYS A:256 , PHE A:258 , PRO A:322 , GOL A:407 , HOH A:529 , HOH A:571binding site for residue GOL A 403
04AC4SOFTWARELEU A:97 , HIS A:100 , ARG A:164 , ASP A:278 , GLN A:284 , HIS A:287 , HOH A:513 , HOH A:517binding site for residue GOL A 404
05AC5SOFTWAREPHE A:202 , THR A:240 , THR A:241 , ASP A:303 , GLN A:325 , GOL A:408 , HOH A:531 , HOH A:532 , HOH A:568binding site for residue GOL A 405
06AC6SOFTWAREVAL A:210 , ASN A:211 , GLU A:264 , SER A:265 , GLN A:266 , HOH A:551binding site for residue GOL A 406
07AC7SOFTWARETYR A:257 , SER A:280 , ARG A:281 , GOL A:403 , HOH A:540binding site for residue GOL A 407
08AC8SOFTWARELYS A:237 , ILE A:238 , THR A:240 , LYS A:242 , ASP A:299 , GOL A:405 , HOH A:524 , HOH A:577binding site for residue GOL A 408
09AC9SOFTWARESER A:98 , HIS A:100 , LYS A:101 , ILE A:103 , VAL A:104 , GLY A:105 , ASP A:127 , HIS A:189 , HOH A:526 , HOH A:587 , HOH A:685binding site for residue GOL A 409
10AD1SOFTWARELYS A:218 , ARG A:226 , HOH A:618 , HOH A:652binding site for residue GOL A 410

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5TE0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5TE0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TE0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TE0)

(-) Exons   (0, 0)

(no "Exon" information available for 5TE0)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:316
                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh..eeee..eeeeeeeeeeee..eeeeeee.....eeeeeeeee.hhhhhhhhhhhhhhhhhhh.......eeeeeee...eeeeeeee....eehhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.........hhh.eee.....eee...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh......hhhhhhhh..ee......hhhhhhhhhhhh........hhhhhhhhhhhhhh....................eehhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5te0 A  26 MTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAK 345
                                    35        45        55        65        75        85        95       105       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339      
                                                                                                                  114|                                                                                                                                                                                                                                  
                                                                                                                   119                                                                                                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TE0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TE0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TE0)

(-) Gene Ontology  (25, 25)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    XIN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5te0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5te0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AAK1_HUMAN | Q2M2I8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AAK1_HUMAN | Q2M2I8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AAK1_HUMAN | Q2M2I84wsq 5l4q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5TE0)