Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  LOCALISED RECONSTRUCTION OF ALPHA V BETA 6 BOUND TO FOOT AND MOUTH DISEASE VIRUS O PANASIA - POSE A PRIME
 
Authors :  A. Kotecha, D. Stuart
Date :  11 Mar 17  (Deposition) - 21 Jun 17  (Release) - 21 Jun 17  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  3.10
Chains :  Asym./Biol. Unit :  A,B,1,2,3,4
Keywords :  Foot And Mouth Disease Virus, Fmdv, Virus, Opanasia, Virus-Receptor, Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Kotecha, Q. Wang, X. Dong, S. L. Ilca, M. Ondiviela, R. Zihe, J. Seago B. Charleston, E. E. Fry, N. G. A. Abrescia, T. A. Springer, J. T. Huiskonen, D. I. Stuart
Rules Of Engagement Between Alpha V Beta 6 Integrin And Foot-And-Mouth Disease Virus.
Nat Commun V. 8 15408 2017
PubMed-ID: 28534487  |  Reference-DOI: 10.1038/NCOMMS15408

(-) Compounds

Molecule 1 - O PANASIA VP1
    Chains1
    EngineeredYES
    Expression SystemCRICETINAE GEN. SP.
    Expression System Taxid36483
    Organism ScientificFOOT-AND-MOUTH DISEASE VIRUS
    Organism Taxid12110
 
Molecule 2 - O PANASIA VP2
    Chains2
    EngineeredYES
    Expression SystemCRICETINAE GEN. SP.
    Expression System Taxid36483
    Organism ScientificFOOT-AND-MOUTH DISEASE VIRUS
    Organism Taxid12110
 
Molecule 3 - O PANASIA VP3
    Chains3
    EngineeredYES
    Expression SystemCRICETINAE GEN. SP.
    Expression System Taxid36483
    MutationYES
    Organism ScientificFOOT-AND-MOUTH DISEASE VIRUS
    Organism Taxid12110
 
Molecule 4 - O PANASIA VP4
    Chains4
    EngineeredYES
    Expression SystemCRICETINAE GEN. SP.
    Expression System Taxid36483
    Organism ScientificFOOT-AND-MOUTH DISEASE VIRUS
    Organism Taxid12110
 
Molecule 5 - INTEGRIN ALPHA-V
    ChainsA
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293S
    Expression System CommonHUMAN
    Expression System Taxid9606
    GeneITGAV, MSK8, VNRA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymVITRONECTIN RECEPTOR SUBUNIT ALPHA
 
Molecule 6 - INTEGRIN BETA-6
    ChainsB
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293S
    Expression System CommonHUMAN
    Expression System Taxid9606
    GeneITGB6
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit AB1234

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 26)

Asymmetric/Biological Unit (3, 26)
No.NameCountTypeFull Name
1CA4Ligand/IonCALCIUM ION
2MAN11Ligand/IonALPHA-D-MANNOSE
3NAG11Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLN A:494 , SER A:522 , ASN A:524binding site for residue NAG A 611
02AC2SOFTWAREASP A:415 , ASN A:417 , TYR A:419 , ASP A:421 , ALA A:437binding site for residue CA A 616
03AC3SOFTWAREASP A:349 , ASP A:351 , ASP A:353 , PHE A:355 , ASP A:357binding site for residue CA A 617
04AC4SOFTWAREASP A:230 , ASN A:232 , ASP A:234 , ILE A:236 , ASP A:238binding site for residue CA A 618
05AC5SOFTWAREASP A:284 , ASN A:286 , ASP A:288 , TYR A:290 , ASP A:292binding site for residue CA A 619
06AC6SOFTWARETYR A:450 , ASN A:455 , ASN A:458 , THR A:460 , CYS A:472 , ASN A:474binding site for Poly-Saccharide residues NAG A 607 through MAN A 610 bound to ASN A 458
07AC7SOFTWAREASN B:77 , SER B:79 , ASP B:80binding site for Mono-Saccharide NAG B 501 bound to ASN B 77
08AC8SOFTWAREASN A:260 , SER A:262binding site for Poly-Saccharide residues NAG A 601 through MAN A 603
09AC9SOFTWARENAG A:601binding site for Poly-Saccharide residues NAG A 605 through MAN A 606
10AD1SOFTWAREPHE A:558 , PRO A:583 , ALA A:584 , ASN A:585binding site for Poly-Saccharide residues NAG A 612 through MAN A 615

(-) SS Bonds  (17, 17)

Asymmetric/Biological Unit
No.Residues
1A:59 -A:67
2A:108 -A:128
3A:142 -A:155
4A:400 -B:267
5A:461 -A:472
6A:478 -A:535
7B:6 -B:24
8B:14 -B:434
9B:17 -B:39
10B:27 -B:50
11B:177 -B:184
12B:232 -B:273
13B:374 -B:386
14B:406 -B:432
15B:436 -B:456
16B:447 -B:459
17B:461 -B:470

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Ala 1:110 -Pro 1:111
2Tyr 1:136 -Gly 1:137
3Leu 2:83 -Pro 2:84
4Tyr A:450 -Pro A:451
5Ala B:85 -Pro B:86
6Ser B:163 -Pro B:164

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5NER)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5NER)

(-) Exons   (0, 0)

(no "Exon" information available for 5NER)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 1 from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee..........hhhhhh...........hhhhhh..eeee.....eee.hhhhh...hhhhhhhh.eeeeeeeeeeeeeee..eeeee....hhhhhh....ee......eeeee........ee..................hhhhhhhhhhh.........eeee..eeeeeeeeeeeeeeeee...................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ner 1   1 TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGNCKYGESHTTNVRGDLQVLAQKVARTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPSEARHKQKIVAPVK 210
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain 2 from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeee..eeeee.....eee.................eee.hhhh..eeeeeeee..........eeee.......hhhhh..eeeeeeeeeeeeee.....eeeeeeeeeee.......hhhhhhhhh.eeee......eeeeee................eeeeeeeeeeeee.......eeeeeeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ner 2   5 EETTLLEDRILTTRNGHTTSTTQSSVGVTYGYATTEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSINKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE 218
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214    

Chain 3 from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................ee..................hhhhhhhhh.ee........ee........eeeeee.....hhhhhhhhhhhh..eeeee..eeeeeee......eeeeeeeee........hhhhhh..eeeeee.....eeeeee........ee.............eeeeeeeeee......eeeeeee....eeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ner 3   1 GIFPVACSDGYGGLVTTDPKTADPAYGKVFNPPRNMLPGRFTNFLDVAEACPTFLRFEGDVPYVTTKTDSDRILAQFDLSLAAKHMSNTFLAGLAQYYTQYSGTINLHFMFTGPTDAKARYMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFTFSIPYLSAADYAYTASDTAETTNVQGWVCLFQITHGKADGDALVVLASAGKDFELRLPVDARTQ 220
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220

Chain 4 from PDB  Type:PROTEIN  Length:47
                                                                               
               SCOP domains ----------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhh.........hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------- PROSITE
                 Transcript ----------------------------------------------- Transcript
                 5ner 4  15 SGNTGSIINNYYMQQYQNSMDTQLGDNDWFSKLASSAFSGLFGALLA  85
                                    24        34     || 68        78       
                                                    40|                    
                                                     65                    

Chain A from PDB  Type:PROTEIN  Length:589
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee..........eeee......eeeeee..............eeeeee......eeee........eee..ee.ee.........eeee..eeeeee...ee............eeeeee..eeeee.....................eee....eeeeee.hhhhhh.eeeeeehhhhhhh............eee....hhhhh.......eeee........eeeeee.hhhhhh.eeeee........eee...........eeee........eeeeee...eee.....eee..eeeeeee.....eeeeeee...........eeeee........eeeeee...hhhhh.eeeeee...........eeee..............eeeeee........eeeeeehhh.eeeee....eeee..eeeee..ee.................eeeeeeee.ee.......eeeeeeeeee.........eee......eeeeeeeee.....eeeeeeeee.hhhhh......eeeeeeeeehhhhhh.......ee......eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ner A   1 FNLDVDSPAEYSGPEGSYFGFAVDFFVPSSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSCPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILL 594
                                    10        20        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262||     273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503|      515       525       535       545       555       565       575       585         
                                                       29|                                                                                                                                                                                                                                    263|                                                                                                                                                                                                                                           503|                                                                                        
                                                        32                                                                                                                                                                                                                                     265                                                                                                                                                                                                                                            506                                                                                        

Chain B from PDB  Type:PROTEIN  Length:448
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhh....eee..ee.......ee....eeeeee..........hhhhh..ee..eeeeee.....eeeeeeee......eeeeeeee......hhhhh...hhhhhhhhhhh....eeeeeeee...........hhhhhhh..............eeeeeeee.hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.....eeeeeeee.....hhhhhhhhh................hhhhhh....hhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhh...eeeeee......eeeeeee.....eee...ee.......eeeeeeeee........eeeeeee......eeeeeee...hhhhh............eeee..eeee.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ner B   5 GCALGGTCEDCLLIGPQCAWCARCDTPCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKVEVNSSKCHNGNGSFQCGVCACHPGHMGPRCE 471
                                 || 16        26 ||   ||52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432     ||443       453       463        
                                10|             28|  42|                                                                                                                                                                                                                                                                                                                                                                                                 438|                               
                                 13              38   50                                                                                                                                                                                                                                                                                                                                                                                                  440                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5NER)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5NER)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5NER)

(-) Gene Ontology  (109, 129)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala 1:110 - Pro 1:111   [ RasMol ]  
    Ala B:85 - Pro B:86   [ RasMol ]  
    Leu 2:83 - Pro 2:84   [ RasMol ]  
    Ser B:163 - Pro B:164   [ RasMol ]  
    Tyr 1:136 - Gly 1:137   [ RasMol ]  
    Tyr A:450 - Pro A:451   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ner
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A6Y878_9PICO | A6Y878
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ITAV_HUMAN | P06756
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ITB6_HUMAN | P18564
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  J3T9N5_9PICO | J3T9N5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A6Y878_9PICO | A6Y878
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ITAV_HUMAN | P06756
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ITB6_HUMAN | P18564
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  J3T9N5_9PICO | J3T9N5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        A6Y878_9PICO | A6Y8785nem
        ITAV_HUMAN | P067561jv2 1l5g 1m1x 1u8c 3ije 4g1e 4g1m 4mmx 4mmy 4mmz 4o02 4um8 4um9 5ffg 5ffo 5nem 5net 5neu
        ITB6_HUMAN | P185641lh9 4um8 4um9 5ffg 5ffo 5nem 5net 5neu
        J3T9N5_9PICO | J3T9N55ne4 5ned 5nem

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5NER)