Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  ENAH EVH1 IN COMPLEX WITH AC-[2-CL-F]-[PROM-1]-[PROM-1]-OH
 
Authors :  M. Barone, Y. Roske
Date :  28 Feb 17  (Deposition) - 24 May 17  (Release) - 24 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.46
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Proline-Rich Motif, Ena/Vasp Inhibitor, Actin, Protein-Protein Interaction, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Barone, Y. Roske
Enah Evh1 In Complex With Ac-[2-Cl-F]-[Prom-1]-[Prom-1]-Oh
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN ENABLED HOMOLOG
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI 'BL21-GOLD(DE3)PLYSS AG'
    Expression System PlasmidPGEX-4T-1
    Expression System Taxid866768
    GeneENAH, MENA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsMISMATCH OF S2A: ONLY BACKBONE OF N-TERMINUS WAS RESOLVED AND MODELLED

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 15)

Asymmetric Unit (4, 15)
No.NameCountTypeFull Name
18SB1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{R},7~{S},10~{S},13~{R})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
28SE4Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{S},7~{R},10~{R},13~{S})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
3CL1Ligand/IonCHLORIDE ION
4SO49Ligand/IonSULFATE ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
18SB-1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{R},7~{S},10~{S},13~{R})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
28SE1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{S},7~{R},10~{R},13~{S})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
3CL-1Ligand/IonCHLORIDE ION
4SO43Ligand/IonSULFATE ION
Biological Unit 2 (3, 5)
No.NameCountTypeFull Name
18SB1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{R},7~{S},10~{S},13~{R})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
28SE1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{S},7~{R},10~{R},13~{S})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
3CL-1Ligand/IonCHLORIDE ION
4SO43Ligand/IonSULFATE ION
Biological Unit 3 (2, 3)
No.NameCountTypeFull Name
18SB-1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{R},7~{S},10~{S},13~{R})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
28SE1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{S},7~{R},10~{R},13~{S})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
3CL-1Ligand/IonCHLORIDE ION
4SO42Ligand/IonSULFATE ION
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
18SB-1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{R},7~{S},10~{S},13~{R})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
28SE1Ligand/Ion(3~{S},7~{R},10~{R},13~{S})-4-[[(3~{S},7~{R},10~{R},13~{S})-4-[(2~{S})-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-EN-13-YL]CARBONYL]-2-OXIDANYLIDENE-1,4-DIAZATRICYCLO[8.3.0.0^{3,7}]TRIDEC-8-ENE-13-CARBOXYLICACID
3CL-1Ligand/IonCHLORIDE ION
4SO41Ligand/IonSULFATE ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREMET A:14 , TYR A:16 , TRP A:23 , ASN A:71 , PHE A:77 , GLN A:79 , ARG A:81 , VAL A:86 , ASN A:90 , HOH A:304 , HOH A:341 , TYR C:16 , ASP C:18 , THR C:30 , LYS C:52 , GLN C:54binding site for residue 8SE A 201
02AC2SOFTWAREARG A:10 , PHE A:32 , ILE A:53 , GLN A:54 , HOH A:312 , THR C:76 , ASN C:90 , HOH C:310 , GLN D:75 , LYS D:94binding site for residue SO4 A 202
03AC3SOFTWAREARG A:34 , HIS A:36 , ARG A:51 , HOH A:305binding site for residue SO4 A 203
04AC4SOFTWAREARG A:84 , GLN A:85 , HOH A:324binding site for residue SO4 A 204
05AC5SOFTWARETYR B:16 , TRP B:23 , LYS B:69 , ASN B:71 , PHE B:77 , GLN B:79 , ARG B:81 , ASN B:90 , HOH B:316 , HOH B:321 , HOH B:336 , HOH B:337 , HOH B:353 , GLN D:4 , TYR D:16 , ASP D:18 , THR D:30 , LYS D:52 , GLN D:54 , VAL D:86 , HOH D:340binding site for residue 8SE B 201
06AC6SOFTWARELYS A:69 , TYR A:70 , GLN A:72 , ALA A:73 , THR A:74 , GLN A:75 , ILE B:6 , GLU B:95 , ASN B:98 , VAL B:99 , SER B:102 , MET B:105 , HIS B:106 , GLU B:109 , HOH B:306 , HOH B:310 , HOH B:354 , ILE C:6 , ASP C:18 , ALA C:19 , VAL C:99 , HIS C:106binding site for residue 8SB B 202
07AC7SOFTWAREARG B:10 , PHE B:32 , ILE B:53 , GLN B:54 , HOH B:309 , HOH B:332 , GLN C:75 , LYS C:94 , THR D:76 , ASN D:90binding site for residue SO4 B 203
08AC8SOFTWAREARG B:47 , HOH B:303binding site for residue SO4 B 204
09AC9SOFTWAREARG B:34 , HIS B:36 , ARG B:51 , HOH B:301 , HOH B:305 , HOH B:307binding site for residue SO4 B 205
10AD1SOFTWAREASP A:18 , THR A:30 , LYS A:52 , GLN A:54 , TYR C:16 , TRP C:23 , THR C:41 , PHE C:77 , GLN C:79 , ARG C:81 , HOH C:352binding site for residue 8SE C 201
11AD2SOFTWAREARG C:34 , HIS C:36 , ARG C:51 , HIS C:56 , HOH C:311binding site for residue SO4 C 202
12AD3SOFTWARETHR C:74 , GLN C:75 , HOH C:301 , HOH C:328 , HOH C:329binding site for residue SO4 C 203
13AD4SOFTWARETYR B:16 , ASP B:18 , THR B:30 , LYS B:52 , GLN B:54 , HOH B:345 , HOH B:347 , MET D:14 , TYR D:16 , TRP D:23 , THR D:74 , PHE D:77 , GLN D:79 , ARG D:81 , HOH D:306 , HOH D:349 , HOH D:359binding site for residue 8SE D 201
14AD5SOFTWARETHR D:74 , GLN D:75 , HOH D:301 , HOH D:311 , HOH D:314 , HOH D:336binding site for residue SO4 D 202
15AD6SOFTWARELYS C:94 , HOH C:304 , LYS D:94 , GLU D:95binding site for residue CL D 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5NAJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5NAJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5NAJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5NAJ)

(-) Exons   (0, 0)

(no "Exon" information available for 5NAJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:110
                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeeee....eeee.hhh...eeeeeeee....eeeeeeee.....eeeeee.......eeee..eeeee....eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 5naj A   2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL 111
                                    11        21        31        41        51        61        71        81        91       101       111

Chain B from PDB  Type:PROTEIN  Length:109
                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeee....eeee.hhh...eeeeeeee....eeeeeeee.....eeeeee.......eeee..eeeee....eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 5naj B   3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL 111
                                    12        22        32        42        52        62        72        82        92       102         

Chain C from PDB  Type:PROTEIN  Length:111
                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeeeee....eeee.hhh...eeeeeeee....eeeeeeee.....eeeeee......eeeee..eeeee....eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 5naj C   1 MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL 111
                                    10        20        30        40        50        60        70        80        90       100       110 

Chain D from PDB  Type:PROTEIN  Length:110
                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeeee....eeee.hhh...eeeeeeee....eeeeeeee.....eeeeee......eeeee..eeeee....eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 5naj D   2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL 111
                                    11        21        31        41        51        61        71        81        91       101       111

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5NAJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5NAJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5NAJ)

(-) Gene Ontology  (15, 15)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    8SB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    8SE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5naj)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5naj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ENAH_HUMAN | Q8N8S7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ENAH_HUMAN | Q8N8S7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ENAH_HUMAN | Q8N8S72ho2 2iyb 2xqn 4my6 5n91 5n9c 5n9p 5nbf 5ncf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5NAJ)