Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYOEM STRUCTURE OF POLYCYSTIN-2 IN COMPLEX WITH CALCIUM AND LIPIDS
 
Authors :  M. Wilkes, M. G. Madej, C. Ziegler
Date :  04 Dec 16  (Deposition) - 18 Jan 17  (Release) - 15 Feb 17  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  4.20
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Ca2+ Signaling, Cryoem, Membrane Protein Structure, Polycystin-2, Trp Channel, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Wilkes, M. G. Madej, L. Kreuter, D. Rhinow, V. Heinz, S. De Sanctis, S. Ruppel, R. M. Richter, F. Joos, M. Grieben, A. C. Pike, J. T. Huiskonen, E. P. Carpenter, W. Kuhlbrandt, R. Witzgall, C. Ziegler
Molecular Insights Into Lipid-Assisted Ca(2+) Regulation Of The Trp Channel Polycystin-2.
Nat. Struct. Mol. Biol. V. 24 123 2017
PubMed-ID: 28092368  |  Reference-DOI: 10.1038/NSMB.3357

(-) Compounds

Molecule 1 - POLYCYSTIN-2
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System CommonHUMAN
    Expression System Taxid9606
    GenePKD2, TRPP2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAUTOSOMAL DOMINANT POLYCYSTIC KIDNEY DISEASE TYPE II PROTEIN,POLYCYSTIC KIDNEY DISEASE 2 PROTEIN,POLYCYSTWIN,R48321, TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL SUBFAMILY P MEMBER 2

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 49)

Asymmetric/Biological Unit (5, 49)
No.NameCountTypeFull Name
1CA5Ligand/IonCALCIUM ION
2CHS8Ligand/Ion4-AMINO-5-CYCLOHEXYL-3-HYDROXY-PENTANOIC ACID
3NAG20Ligand/IonN-ACETYL-D-GLUCOSAMINE
4PLM12Ligand/IonPALMITIC ACID
5PX64Ligand/Ion1,2-DIPALMITOYL-SN-GLYCERO-3-PHOSPHATE

(-) Sites  (42, 42)

Asymmetric Unit (42, 42)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:298 , ASN A:299 , THR A:301binding site for residue NAG A 1005
02AC2SOFTWARETRP A:380 , GLN A:557 , ASN A:560 , ASN B:653 , VAL B:655binding site for residue PX6 A 1006
03AC3SOFTWAREPHE A:567 , PHE A:574 , TYR B:611 , PHE B:667binding site for residue PLM A 1007
04AC4SOFTWARETRP A:380 , GLN A:630binding site for residue PLM A 1008
05AC5SOFTWAREGLN A:630 , CHS D:1010binding site for residue PLM A 1009
06AC6SOFTWARETHR A:238 , GLN B:613 , PHE B:629 , PLM B:1009binding site for residue CHS A 1010
07AC7SOFTWARELEU A:231 , ILE A:232 , CYS A:235 , ILE A:236 , TYR A:239binding site for residue CHS A 1011
08AC8SOFTWAREASN A:681 , ASN B:681 , ASN C:681 , ASN D:681binding site for residue CA A 1012
09AC9SOFTWARESER B:298 , ASN B:299 , THR B:301binding site for residue NAG B 1005
10AD1SOFTWARETRP B:380 , GLN B:557 , ASN B:560 , ASN C:653 , VAL C:655binding site for residue PX6 B 1006
11AD2SOFTWARETRP B:507 , PHE B:567 , PHE B:574 , PHE C:667binding site for residue PLM B 1007
12AD3SOFTWARETRP B:380 , GLN B:630binding site for residue PLM B 1008
13AD4SOFTWARECHS A:1010 , GLN B:630binding site for residue PLM B 1009
14AD5SOFTWARETHR B:238 , GLN C:613 , PHE C:629 , PLM C:1009binding site for residue CHS B 1010
15AD6SOFTWARELEU B:231 , ILE B:232 , CYS B:235 , ILE B:236 , TYR B:239binding site for residue CHS B 1011
16AD7SOFTWARELEU A:641 , LEU B:641 , LEU C:641 , LEU D:641binding site for residue CA B 1012
17AD8SOFTWARESER C:298 , ASN C:299 , THR C:301binding site for residue NAG C 1005
18AD9SOFTWARETRP C:380 , GLN C:557 , ASN C:560 , ASN D:653 , VAL D:655binding site for residue PX6 C 1006
19AE1SOFTWAREPHE C:567 , PHE C:574 , TYR D:611 , PHE D:667binding site for residue PLM C 1007
20AE2SOFTWARETRP C:380 , GLN C:630binding site for residue PLM C 1008
21AE3SOFTWARECHS B:1010 , GLN C:630binding site for residue PLM C 1009
22AE4SOFTWARETHR C:238 , GLN D:613 , PHE D:629 , PLM D:1009binding site for residue CHS C 1010
23AE5SOFTWARELEU C:231 , ILE C:232 , CYS C:235 , ILE C:236 , TYR C:239binding site for residue CHS C 1011
24AE6SOFTWARESER D:298 , ASN D:299 , THR D:301binding site for residue NAG D 1005
25AE7SOFTWAREASN A:653 , VAL A:655 , TRP D:380 , GLN D:557 , ASN D:560binding site for residue PX6 D 1006
26AE8SOFTWARETYR A:611 , PHE A:667 , PHE D:567 , PHE D:574binding site for residue PLM D 1007
27AE9SOFTWARETRP D:380 , GLN D:630binding site for residue PLM D 1008
28AF1SOFTWARECHS C:1010 , GLN D:630binding site for residue PLM D 1009
29AF2SOFTWAREGLN A:613 , PHE A:629 , PLM A:1009 , THR D:238binding site for residue CHS D 1010
30AF3SOFTWARELEU D:231 , ILE D:232 , CYS D:235 , ILE D:236 , TYR D:239binding site for residue CHS D 1011
31AF4SOFTWAREASN A:328 , GLY A:329 , LYS A:342 , GLU A:343 , CYS A:344binding site for Mono-Saccharide NAG A 1001 bound to ASN A 328
32AF5SOFTWAREPRO A:360 , ARG A:361 , ASN A:362binding site for Mono-Saccharide NAG A 1002 bound to ASN A 362
33AF6SOFTWAREASN B:328 , GLY B:329 , LYS B:342 , GLU B:343 , CYS B:344binding site for Mono-Saccharide NAG B 1001 bound to ASN B 328
34AF7SOFTWAREPRO B:360 , ARG B:361 , ASN B:362binding site for Mono-Saccharide NAG B 1002 bound to ASN B 362
35AF8SOFTWAREASN C:328 , GLY C:329 , LYS C:342 , GLU C:343 , CYS C:344binding site for Mono-Saccharide NAG C 1001 bound to ASN C 328
36AF9SOFTWAREPRO C:360 , ARG C:361 , ASN C:362binding site for Mono-Saccharide NAG C 1002 bound to ASN C 362
37AG1SOFTWAREASN D:328 , GLY D:329 , LYS D:342 , GLU D:343 , CYS D:344binding site for Mono-Saccharide NAG D 1001 bound to ASN D 328
38AG2SOFTWAREPRO D:360 , ARG D:361 , ASN D:362binding site for Mono-Saccharide NAG D 1002 bound to ASN D 362
39AG3SOFTWAREASP A:373 , LEU A:374 , ASN A:375binding site for Poly-Saccharide residues NAG A 1003 through NAG A 1004
40AG4SOFTWAREASP B:373 , LEU B:374 , ASN B:375binding site for Poly-Saccharide residues NAG B 1003 through NAG B 1004
41AG5SOFTWAREASP C:373 , LEU C:374 , ASN C:375binding site for Poly-Saccharide residues NAG C 1003 through NAG C 1004
42AG6SOFTWAREASP D:373 , LEU D:374 , ASN D:375binding site for Poly-Saccharide residues NAG D 1003 through NAG D 1004

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:331 -A:344
2B:331 -B:344
3C:331 -C:344
4D:331 -D:344

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5MKF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MKF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MKF)

(-) Exons   (0, 0)

(no "Exon" information available for 5MKF)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:481
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh....................eeeeeeeeeee..........hhhhhh.........hhhhh.....................................eeee...hhhhhhhhhhhhhhhh........eeeeeeeee.....eeeeeeeee.......eeeeeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mkf A 215 KYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQK 695
                                   224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694 

Chain B from PDB  Type:PROTEIN  Length:481
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh....................eeeeeeeeeee..........hhhhhh.........hhhhh.....................................eeee...hhhhhhhhhhhhhhhh........eeeeeeeee.....eeeeeeeee.......eeeeeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mkf B 215 KYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQK 695
                                   224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694 

Chain C from PDB  Type:PROTEIN  Length:481
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh....................eeeeeeeeeee..........hhhhhh.........hhhhh.....................................eeee...hhhhhhhhhhhhhhhh........eeeeeeeee.....eeeeeeeee.......eeeeeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mkf C 215 KYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQK 695
                                   224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694 

Chain D from PDB  Type:PROTEIN  Length:481
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh....................eeeeeeeeeee..........hhhhhh.........hhhhh.....................................eeee...hhhhhhhhhhhhhhhh........eeeeeeeee.....eeeeeeeee.......eeeeeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mkf D 215 KYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQK 695
                                   224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MKF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MKF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MKF)

(-) Gene Ontology  (101, 101)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CHS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PX6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5mkf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mkf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PKD2_HUMAN | Q13563
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PKD2_HUMAN | Q13563
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PKD2_HUMAN | Q135632kld 2kle 2kq6 2y4q 3hrn 3hro 5k47 5mke 5t4d

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MKF)