Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  KINASE DOMAIN OF HUMAN GREATWALL
 
Authors :  M. B. Rajasekaran, L. H. Pearl, A. W. Oliver
Date :  09 Aug 16  (Deposition) - 07 Sep 16  (Release) - 18 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Kinase Domain, Inhibitor, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. A. Ocasio, M. B. Rajasekaran, S. Walker, D. Le Grand, J. Spencer, F. M. Pearl, S. E. Ward, V. Savic, L. H. Pearl, H. Hochegger, A. W. Oliver
A First Generation Inhibitor Of Human Greatwall Kinase, Enabled By Structural And Functional Characterisation Of A Minimal Kinase Domain Construct.
Oncotarget V. 7 71182 2016
PubMed-ID: 27563826  |  Reference-DOI: 10.18632/ONCOTARGET.11511

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE GREATWALL,SERINE/THREONINE- PROTEIN KINASE GREATWALL
    ChainsA, B
    EC Number2.7.11.1, 2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPTHREE-E
    Expression System Taxid469008
    Expression System VariantROSETTA2
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 1-194,UNP RESIDUES 740-879
    GeneMASTL, GW, GWL, THC2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymHGWL,MICROTUBULE-ASSOCIATED SERINE/THREONINE-PROTEIN KINASE- LIKE,MAST-L,HGWL,MICROTUBULE-ASSOCIATED SERINE/THREONINE-PROTEIN KINASE-LIKE,MAST-L

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric Unit (3, 6)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2EDO3Ligand/Ion1,2-ETHANEDIOL
3STU2Ligand/IonSTAUROSPORINE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO1Ligand/Ion1,2-ETHANEDIOL
3STU1Ligand/IonSTAUROSPORINE
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO2Ligand/Ion1,2-ETHANEDIOL
3STU1Ligand/IonSTAUROSPORINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:41 , ALA A:60 , MET A:110 , GLU A:111 , TYR A:112 , LEU A:113 , GLY A:116 , ASP A:117 , ASP A:160 , LEU A:163 , THR A:173 , ASP A:174 , SER A:178binding site for residue STU A 901
2AC2SOFTWAREASP A:145 , HIS A:148 , TRP A:761 , ARG B:753binding site for residue CL A 902
3AC3SOFTWARESER A:120 , ILE A:124binding site for residue EDO A 903
4AC4SOFTWAREILE B:41 , SER B:42 , ALA B:60 , LYS B:62 , GLU B:111 , TYR B:112 , LEU B:113 , GLY B:116 , ASP B:117 , ASP B:160 , ASN B:161 , LEU B:163 , THR B:173 , ASP B:174 , LEU B:177binding site for residue STU B 901
5AC5SOFTWAREARG B:793 , TRP B:797binding site for residue EDO B 902
6AC6SOFTWAREASP B:68 , HOH B:1008binding site for residue EDO B 903

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5LOH)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Gly A:740 -Thr A:741
2Ala A:754 -His A:755
3Gln A:853 -Pro A:854
4Gly B:44 -Ala B:45
5Gly B:740 -Thr B:741
6Gln B:853 -Pro B:854

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LOH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LOH)

(-) Exons   (0, 0)

(no "Exon" information available for 5LOH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:248
                                                                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhheeeee...eeeeee....eeeeeeee...............eee......eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee...............hhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhh.hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5loh A  30 PSIEEFSIVKPISGKVYLGQKGGKLYAVKVVKKADMLALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLSKFCGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFNDETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDWENLQHQTMPFIPQP 854
                                    39  ||    53        63     || 88        98       108       118       128       138       148       158       168       178||     746       756       766       776       786       796       806       816       826       836       846        
                                       42|                    69|                                                                                           179|                                                                                                                    
                                        47                     85                                                                                            738                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:250
                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhee..........eeeeee....eeeeeeeehhhhhhh..........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee...........hhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhh........hhhhh.hhhhhhhhhhhh........hhhhhhh.......hhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5loh B  30 PSIEEFSIVKPISRGAFGKVYLGQKGGKLYAVKVVKKADMINKALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFNDETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDWENLQHQTMPFIPQP 854
                                    39        49        59        69  ||    92       102       112       122       132       142       152       162       172    || 744       754       764       774       784       794       804       814       824       834       844       854
                                                                     72|                                                                                        177|                                                                                                                  
                                                                      86                                                                                         740                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LOH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LOH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LOH)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    STU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:754 - His A:755   [ RasMol ]  
    Gln A:853 - Pro A:854   [ RasMol ]  
    Gln B:853 - Pro B:854   [ RasMol ]  
    Gly A:740 - Thr A:741   [ RasMol ]  
    Gly B:44 - Ala B:45   [ RasMol ]  
    Gly B:740 - Thr B:741   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5loh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GWL_HUMAN | Q96GX5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GWL_HUMAN | Q96GX5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5LOH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5LOH)