Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  MODEL OF HUMAN ANAPHASE-PROMOTING COMPLEX/CYCLOSOME (APC/C-CDH1) WITH E2 UBE2S POISED FOR POLYUBIQUITINATION WHERE UBE2S, APC2, AND APC11 ARE MODELED INTO LOW RESOLUTION DENSITY
 
Authors :  N. G. Brown, R. Vanderlinden, P. Dube, D. Haselbach, J. M. Peters, H. Sta B. A. Schulman
Date :  11 Jun 16  (Deposition) - 26 Oct 16  (Release) - 02 Nov 16  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  6.40
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,R,S,T,W,X,Y
Keywords :  Ubiquitination, Multi-Protein Complex, Cell Division, Conformational Regulation, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. G. Brown, R. Vanderlinden, E. R. Watson, F. Weissmann, A. Ordureau, K. P. Wu, W. Zhang, S. Yu, P. Y. Mercredi, J. S. Harrison, I. F. Davidson, R. Qiao, Y. Lu, P. Dube, M. R. Brunner, C. R. Grace, D. J. Miller, D. Haselbach, M. A. Jarvis, M. Yamaguchi, D. Yanishevski, G. Petzold, S. S. Sidhu, B. Kuhlman, M. W. Kirschner, J. W. Harper, J. M. Peters, H. Stark, B. A. Schulman
Dual Ring E3 Architectures Regulate Multiubiquitination And Ubiquitin Chain Elongation By Apc/C.
Cell V. 165 1440 2016
PubMed-ID: 27259151  |  Reference-DOI: 10.1016/J.CELL.2016.05.037

(-) Compounds

Molecule 1 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
    ChainsA
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC1, TSG24
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC1,CYCLOSOME SUBUNIT 1,MITOTIC CHECKPOINT REGULATOR, TESTIS-SPECIFIC GENE 24 PROTEIN
 
Molecule 2 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 11
    ChainsB
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC11, HSPC214
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC11,CYCLOSOME SUBUNIT 11,HEPATOCELLULAR CARCINOMA- ASSOCIATED RING FINGER PROTEIN
 
Molecule 3 - CELL DIVISION CYCLE PROTEIN 23 HOMOLOG
    ChainsC, P
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneCDC23, ANAPC8
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANAPHASE-PROMOTING COMPLEX SUBUNIT 8,APC8,CYCLOSOME SUBUNIT 8
 
Molecule 4 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 15
    ChainsD
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC15, C11ORF51, HSPC020
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC15
 
Molecule 5 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 16
    ChainsE
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC16, C10ORF104, CENP-27
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC16,CYCLOSOME SUBUNIT 16
 
Molecule 6 - CELL DIVISION CYCLE PROTEIN 27 HOMOLOG
    ChainsF, H
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneCDC27, ANAPC3, D0S1430E, D17S978E
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANAPHASE-PROMOTING COMPLEX SUBUNIT 3,APC3,CDC27 HOMOLOG, CDC27HS,H-NUC
 
Molecule 7 - ANAPHASE-PROMOTING COMPLEX SUBUNIT CDC26
    ChainsG, W
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneCDC26, ANAPC12, C9ORF17
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANAPHASE-PROMOTING COMPLEX SUBUNIT 12,APC12,CELL DIVISION CYCLE PROTEIN 26 HOMOLOG
 
Molecule 8 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 4
    ChainsI
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC4, APC4
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC4,CYCLOSOME SUBUNIT 4
 
Molecule 9 - CELL DIVISION CYCLE PROTEIN 16 HOMOLOG
    ChainsJ, K
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneCDC16, ANAPC6
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANAPHASE-PROMOTING COMPLEX SUBUNIT 6,APC6,CDC16 HOMOLOG, CDC16HS,CYCLOSOME SUBUNIT 6
 
Molecule 10 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 10
    ChainsL
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC10, APC10
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC10,CYCLOSOME SUBUNIT 10
 
Molecule 11 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 13
    ChainsM
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC13
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC13,CYCLOSOME SUBUNIT 13
 
Molecule 12 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 2
    ChainsN
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC2, APC2, KIAA1406
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC2,CYCLOSOME SUBUNIT 2
 
Molecule 13 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 5
    ChainsO
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC5, APC5
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC5,CYCLOSOME SUBUNIT 5
 
Molecule 14 - FIZZY-RELATED PROTEIN HOMOLOG
    ChainsR
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneFZR1, CDH1, FYR, FZR, KIAA1242
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFZR,CDC20-LIKE PROTEIN 1,CDH1/HCT1 HOMOLOG,HCDH1
 
Molecule 15 - UBIQUITIN_VARIANT-HSL1(SUBSTRATE) FUSION
    ChainsS
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneUBB, HSL1, YKL101W, YKL453
    Organism CommonHUMAN, BAKER'S YEAST
    Organism ScientificHOMO SAPIENS, SACCHAROMYCES CEREVISIAE (STRAIN ATCC 204508 / S288C)
    Organism Taxid9606, 559292
    Other DetailsTHIS CONSTRUCT COMPRISES A UBIQUITIN VARIANT(UBV) FUSED TO APC/C SUBSTRATE HSL1 RESIDUES 818-842
    StrainATCC 204508 / S288C
 
Molecule 16 - UBIQUITIN-CONJUGATING ENZYME E2 S
    ChainsT
    EC Number2.3.2.23
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneUBE2S, E2EPF, OK/SW-CL.73
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsTHIS CONSTRUCT AS AN N-TERMINAL REMNANT OF CLEAVAGE SITE AND LINKER. C95 OF THIS CONSTRUCT IS CROSS-LINKED TO UBV K11C AND UB G75C VIA TMEA.
    SynonymE2 UBIQUITIN-CONJUGATING ENZYME S,E2-EPF,UBIQUITIN CARRIER PROTEIN S,UBIQUITIN-CONJUGATING ENZYME E2-24 KDA,UBIQUITIN- CONJUGATING ENZYME E2-EPF5,UBIQUITIN-PROTEIN LIGASE S
 
Molecule 17 - ANAPHASE-PROMOTING COMPLEX SUBUNIT 7
    ChainsX, Y
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    GeneANAPC7, APC7
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC7,CYCLOSOME SUBUNIT 7

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPRSTWXY

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5L9T)

(-) Sites  (0, 0)

(no "Site" information available for 5L9T)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5L9T)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5L9T)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5L9T)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5L9T)

(-) Exons   (0, 0)

(no "Exon" information available for 5L9T)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:1380
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eee...hhhhhhhh....eeeeee...........eeeeee...eeeee...........eeee.........eeeee...eeeeeeee....eeeee....eee......eeee......eeeee.....eeee......................eeeeee....eeeeee....eeeeeee..........eeeee......eeeeee.....eeeeeee....eeeeeeeee...eee..eeee...eeeee....eeeeee...eeeee....eeee.......eeeee.....eeeeee....eeeee.......hhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhh.hhhhhhhh............hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhhhhhh..........hhhhhhhhhh..............hhhhhhhhhhhhhh..hhhhhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhh.......hhhhhh...hhh...........hhhhhhh.....hhhhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....................eeee....eeee.............hhhhhhhhhhhhhh........hhhhhhh.......hhhhhhhhhhhhhh.hhhh..hhhhhhhhhh..hhhhhhhhhhhhhhh.....hhhhhhhhhh...............hhhhhhhhhhhhhh......hhhhhhhhhhh.............hhhhhhhhhhhhhhhh..............hhhhhhhhhh................hhhhhhhhhhhhhhh......hhhhhh......hhhhhh..hhhhhhhhhhhhhh........hhhhhhh..hhhhh...hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh....hhhh.hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh......hhhhhhhhhhhhhh......eee....hhhhhhhhh................hhhhhhhhhheee...eee..........eeeeeee......eeeeeee..........eeeeee......eeee...hhhhhhhh...eee.......................................................................................................................................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                5l9t A   11 MIAARDLQEFVPFGRDHCKHHPKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSPLPTMFSMLHPLDEITPLVCKVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSVPELCIDHLWTNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPHSEWNLFVTCLMNMMGYDDDWEYLLNSDYHQNVESHLLNRSLCLSTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQDDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLTQHLKSILSKDGVLYVKLRAGLLSFAEYFCLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSLEESQLSMLACFLVYHSVPAPSTSFAELLFKFKQLKMPVRALLRLA 1932
                                    20        30 ||     78        88        98       108       118       128     ||149       159       169       179       189  ||   212       222   ||  241       251       261       271    || 408     ||427       437       447       457  ||   470       480       490       500       510 ||    588       598       608       618       628       638       648|      663      |706       716       726    || 761       771       781       791       801       811  ||   845       855       865       875      |926       936       946       956       966       976       986|     1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282      1292      1302      1312      1322      1332||    1355      1365      1375      1385      1395      1405      1415      1425      1435 ||   1459      1469      1479      1489      1499      1509      1519      1529      1539      1549      1559      1569      1579      1589      1599      1609      1619      1629      1639      1649      1659      1669      1679||    1692      1702 ||   1754||    1778      1788      1798      1808      1818      1839      1849      1859      1869   || 1882      1892    ||1912      1922      1932
                                                32|                                                            134|                                           192|                 226|                                     276|       414|                                 460|                                             512|                                                                648|             670|                        731|                                                      814|                                        882|                                                           986|                                                                                                                                                                                                                                                                                                                            1333|                                                                                      1437|                                                                                                                                                                                                                                1680|                1704|    1755|                                                     1827|                              1873|                1897|                        
                                                 71                                                             146                                            206                  236                                      404        424                                  464                                              581                                                                 654              704                         757                                                       839                                         924                                                           1013                                                                                                                                                                                                                                                                                                                             1347                                                                                       1452                                                                                                                                                                                                                                 1684                 1747     1770                                                      1839                               1877                 1908                        

Chain B from PDB  Type:PROTEIN  Length:68
                                                                                                     
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author eeeee............................eee.....eeehhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                5l9t B    4 KIKCWNGVATWDENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQHCPMCRQEWKFKE   84
                                    13||      28        42        52        62   ||   76        
                                     14|               37|                      66|             
                                      20                42                       71             

Chain C from PDB  Type:PROTEIN  Length:475
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhh.....hhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh...hhhhhh......hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t C   26 FSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSC  500
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495     

Chain D from PDB  Type:PROTEIN  Length:55
                                                                                        
               SCOP domains ------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------- Pfam domains
         Sec.struct. author ........................hhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------- Transcript
                5l9t D    2 STLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGK   56
                                    11        21        31        41        51     

Chain E from PDB  Type:PROTEIN  Length:56
                                                                                         
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                5l9t E   52 RFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTP  107
                                    61        71        81        91       101      

Chain F from PDB  Type:PROTEIN  Length:482
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhhhhhhh.....hhhhhhhhhhhhh...hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.........hhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t F    5 QEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDL  766
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164     ||454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744       754       764  
                                                                                                                                                                                               170|                                                                                                                                                                                                                                                                                                                           
                                                                                                                                                                                                451                                                                                                                                                                                                                                                                                                                           

Chain G from PDB  Type:PROTEIN  Length:25
                                                          
               SCOP domains ------------------------- SCOP domains
               CATH domains ------------------------- CATH domains
               Pfam domains ------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------- SAPs(SNPs)
                    PROSITE ------------------------- PROSITE
                 Transcript ------------------------- Transcript
                5l9t G    1 MLRRKPTRLELKLDDIEEFENIRKD   25
                                    10        20     

Chain H from PDB  Type:PROTEIN  Length:483
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhhhhhhh.....hhhhhhhhhhhhh...hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhh......hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh........hhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t H    5 QEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLD  771
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164     ||454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744       754       764 ||
                                                                                                                                                                                               170|                                                                                                                                                                                                                                                                                                                        766|
                                                                                                                                                                                                451                                                                                                                                                                                                                                                                                                                         771

Chain I from PDB  Type:PROTEIN  Length:727
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .................eeeeee......eeeee....eeee..hhh.eeeee.........eeeeee.....eeeeee.....eeeee.....eeeee.......eeee...............hhhh...........................hhhhhh......eeee....-----hhh.eeeeeee....eeeeeee.....eeeeeee..........eeeee.hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.......hhhhhh...............hhhhhhh...hhhh............hhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...................eeeee....eeeeeeeee....eeeeeeeee..........eeeeeeeee............eeeeeeee....eeeeeeee........eeeeeeehhhh.....hhh...................eeeeee...eee.....eeeeee.....eeeeee.....eeeee......... Sec.struct. author (1)
     Sec.struct. author (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------eeeeee----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t I    6 TCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEKMTQKDITFVAEFLTEHFNFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWEL  754
                                    15        25        35        45        55        65        75        85        95       105       115       125   ||  137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427  ||   445       455 ||    477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       
                                                                                                                                                     129|                                                                                                                                                                                                                                                                                                       430|               457|                                                                                                                                                                                                                                                                                            
                                                                                                                                                      132                                                                                                                                                                                                                                                                                                        439                470                                                                                                                                                                                                                                                                                            

Chain J from PDB  Type:PROTEIN  Length:504
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhh..hhhhh.hhhhhhhhhhhhh....hhhhhh...hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhhhh......................hhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhh...hhhhhhhhhhhhh.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhh...........hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                5l9t J    2 NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY  533
                                    11        21        31        41        51        61        71        81        91  ||   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529    
                                                                                                                       94|                                                                                                                                                                                                                                                                                                                                                                                                                          
                                                                                                                       123                                                                                                                                                                                                                                                                                                                                                                                                                          

Chain K from PDB  Type:PROTEIN  Length:493
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhh....hhhhhhhhh.......hhhhhhhhhhhhhhhh........hhhhhh..hhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t K    2 NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI  527
                                    11        21        31        41        51        61        71        81        91 ||    134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524   
                                                                                                                      93|                                                                                                                                                                                                                                                                                                                                                                                                                
                                                                                                                      127                                                                                                                                                                                                                                                                                                                                                                                                                

Chain L from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                           
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh..eee.....eeee........hhhhhh..............eeeeee....eee.eeeee............eeeeeee......eeeeeee......eeeee........eee.eeeeee...hhh.......eeeeeee.........hhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t L   11 ADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEKFPRCTTIDFMMYRSIR  184
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160  ||   174       184
                                                                                                                                                                                  163|                
                                                                                                                                                                                   168                

Chain M from PDB  Type:PROTEIN  Length:42
                                                                           
               SCOP domains ------------------------------------------ SCOP domains
               CATH domains ------------------------------------------ CATH domains
               Pfam domains ------------------------------------------ Pfam domains
         Sec.struct. author ........hhhhhhh........................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------ PROSITE
                 Transcript ------------------------------------------ Transcript
                5l9t M    1 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIWTDLALQYLHE   67
                                    10        20        30||      65  
                                                         31|          
                                                          57          

Chain N from PDB  Type:PROTEIN  Length:546
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhh..hhhhhhhhh.............hhhhhhhhhhhh.hhhhhh.....hhhhhhhhhhhhhhh....hhhhhhhhhhhh......hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhhh..hhhhhhhh...hhhhhh...hhhhhhhhhh.hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh................................hhhhhhhhhhhhhhh..........eeee..hhhhhhhhhhh......hhhhhhhh...hhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                5l9t N   17 GQELLVAWNTVSTEELRAAVEVLRGHVLEEWFVEVLQNDLQANISPEFWNAISQCENSACLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTDLAVELSKSSDIISLLVSIYDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLSWKHTLGLVTMDVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER  720
                                    26  ||    59     || 73        83        93       107       117       127       137     ||152       162       172       182       233       243       253       263       273       283       293       303||     328       338       348       358       368       378       388       398       408       418       428       438    || 455  ||   504    || 517       527       537       547       557       567       577       587       597       607       617       627||     643    || 664       674       684       694       704       714      
                                       29|          65|                             102|                                 143|                                      190|                                                                     304|                                                                                                                        443|    458|        509|                                                                                                                628|          648|                                                            
                                        53           70                              107                                  149                                       232                                                                      320                                                                                                                         451     498         513                                                                                                                 635           660                                                            

Chain O from PDB  Type:PROTEIN  Length:685
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.....hhhhhhhhhhh...hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t O   27 KDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSVPLINHL  755
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166  ||   212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452|      468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       750     
                                                                                                                                                                        169|                                                                                                                                                                                                                                                   452|                                                                                                                                                                                                                                                                                            746|      
                                                                                                                                                                         206                                                                                                                                                                                                                                                    459                                                                                                                                                                                                                                                                                             749      

Chain P from PDB  Type:PROTEIN  Length:443
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh...hhhhhh......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhh....hhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t P   26 FSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL  480
                                    35        45        55        65        75        85        95       105       115       125       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477   
                                                                                                                                      134|                                                                                                                                                                                                                                                                                                                                             
                                                                                                                                       147                                                                                                                                                                                                                                                                                                                                             

Chain R from PDB  Type:PROTEIN  Length:385
                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhh......hhhhhhhhhhh..........................hhhhhhhh......eeee............eee....eeeeee..eeeeee.....eeeeee.......eeeeee.....eeeeee....eeeee....eeeeee......eeeeeee..eeeeee...eeeeee......eeeeee.........eee.....eeeee.....eeeee.......eee........eeee......eeeee......eeeeee.....eeeeee....eeeeee.....eeeeee......eeeee..................eeee.....eeeeee...eeeeee.......hhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t R   42 SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSSKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVVSVLNLFTRIR  493
                                    51        61     || 91       101      |127    || 150       160  ||   178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468   ||  488     
                                                    67|                 108|    132|              163|                                                                                                                                                                                                                                                                                                         472|          
                                                     88                  125     146               172                                                                                                                                                                                                                                                                                                          483          

Chain S from PDB  Type:PROTEIN  Length:84
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeee......hhhhhhhhhhhh...hhheeeee...........hhh......eeeeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                5l9t S    1 MQILVKTPRGCTITLEVEPSDTIENVKAKIQDKEGIPPDQQILFFAVKRLEDGRTLSDYNIQKKSSLLLAMRVPRAALSDITNS  837
                                    10        20        30        40        50        60        70   ||  833    
                                                                                                    74|         
                                                                                                    828         

Chain T from PDB  Type:PROTEIN  Length:97
                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeee..eeee................hhhh....hhhhhhhhhhhh...hhh...hhhhhhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                5l9t T   46 TIEGPEGTPYAGGLFRMKLLPPKGYFLTKIFHPNVGANGEICVNVLKRDIRHVLLTIKFLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHG  156
                                    55        65|       83        93       109       119       129       139       149       
                                              65|                         102|                                               
                                               74                          109                                               

Chain W from PDB  Type:PROTEIN  Length:25
                                                          
               SCOP domains ------------------------- SCOP domains
               CATH domains ------------------------- CATH domains
               Pfam domains ------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------- SAPs(SNPs)
                    PROSITE ------------------------- PROSITE
                 Transcript ------------------------- Transcript
                5l9t W    1 MLRRKPTRLELKLDDIEEFENIRKD   25
                                    10        20     

Chain X from PDB  Type:PROTEIN  Length:397
                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh..hhhhhhhhh........hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t X   36 NVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLE  453
                                    45        55        65        75        85        95       105    || 136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       
                                                                                                    110|                                                                                                                                                                                                                                                                                                                                 
                                                                                                     132                                                                                                                                                                                                                                                                                                                                 

Chain Y from PDB  Type:PROTEIN  Length:416
                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh..hhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l9t Y   36 NVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQR  472
                                    45        55        65        75        85        95       105    || 136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466      
                                                                                                    110|                                                                                                                                                                                                                                                                                                                                                    
                                                                                                     132                                                                                                                                                                                                                                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5L9T)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5L9T)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5L9T)

(-) Gene Ontology  (160, 392)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5l9t)
 
  Sites
(no "Sites" information available for 5l9t)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5l9t)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5l9t
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANC2_HUMAN | Q9UJX6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC10_HUMAN | Q9UM13
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC11_HUMAN | Q9NYG5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC13_HUMAN | Q9BS18
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC15_HUMAN | P60006
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC16_HUMAN | Q96DE5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC1_HUMAN | Q9H1A4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC4_HUMAN | Q9UJX5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC5_HUMAN | Q9UJX4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  APC7_HUMAN | Q9UJX3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CDC16_HUMAN | Q13042
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CDC23_HUMAN | Q9UJX2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CDC26_HUMAN | Q8NHZ8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CDC27_HUMAN | P30260
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FZR1_HUMAN | Q9UM11
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  HSL1_YEAST | P34244
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_HUMAN | P0CG47
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBE2S_HUMAN | Q16763
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.2.23
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ANC2_HUMAN | Q9UJX6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC10_HUMAN | Q9UM13
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC11_HUMAN | Q9NYG5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC13_HUMAN | Q9BS18
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC15_HUMAN | P60006
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC16_HUMAN | Q96DE5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC1_HUMAN | Q9H1A4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC4_HUMAN | Q9UJX5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC5_HUMAN | Q9UJX4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  APC7_HUMAN | Q9UJX3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CDC16_HUMAN | Q13042
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CDC23_HUMAN | Q9UJX2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CDC26_HUMAN | Q8NHZ8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CDC27_HUMAN | P30260
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FZR1_HUMAN | Q9UM11
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  HSL1_YEAST | P34244
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UBB_HUMAN | P0CG47
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UBE2S_HUMAN | Q16763
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANC2_HUMAN | Q9UJX64ui9 4yii 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        APC10_HUMAN | Q9UM131jhj 4ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        APC11_HUMAN | Q9NYG52mt5 4r2y 4ui9 5a31 5g04 5g05 5jg6 5khr 5khu 5l9u 5lcw
        APC13_HUMAN | Q9BS184ui9 5g04 5khr 5khu 5l9u 5lcw
        APC15_HUMAN | P600064ui9 5a31 5g04 5g05 5l9u 5lcw
        APC16_HUMAN | Q96DE54rg6 4rg9 4ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        APC1_HUMAN | Q9H1A44ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw 5lgg
        APC4_HUMAN | Q9UJX54ui9 5a31 5bpw 5g04 5g05 5khr 5khu 5l9u 5lcw
        APC5_HUMAN | Q9UJX44ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        APC7_HUMAN | Q9UJX33ffl 4ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        CDC16_HUMAN | Q130423hym 4ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        CDC23_HUMAN | Q9UJX24ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        CDC26_HUMAN | Q8NHZ83hym 4ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        CDC27_HUMAN | P302603t1n 4rg6 4rg7 4rg9 4ui9 5a31 5g04 5g05 5khr 5khu 5l9u 5lcw
        FZR1_HUMAN | Q9UM114ui9 5l9u
        HSL1_YEAST | P342445g04 5khr 5l9u
        UBB_HUMAN | P0CG471c3t 1cmx 1d3z 1f9j 1fxt 1g6j 1gjz 1nbf 1q5w 1s1q 1sif 1tbe 1ubi 1ubq 1ud7 1uzx 1xd3 1yx5 1yx6 1zo6 2ayo 2bgf 2den 2fuh 2g45 2gbj 2gbk 2gbm 2gbn 2gbr 2hth 2ibi 2j7q 2jf5 2jzz 2k6d 2k8b 2k8c 2kdf 2khw 2kjh 2klg 2kn5 2kox 2ktf 2kwu 2kwv 2l0f 2l0t 2mbb 2mro 2msg 2n13 2nr2 2o6v 2ojr 2pe9 2pea 2w9n 2wdt 2xew 2xk5 2y5b 2zcb 3a33 3by4 3c0r 3dvg 3dvn 3eec 3efu 3ehv 3h7p 3h7s 3hm3 3i3t 3ifw 3ihp 3jsv 3jvz 3jw0 3k9p 3kvf 3kw5 3ldz 3mhs 3mtn 3n30 3n32 3n3k 3nhe 3nob 3ns8 3o65 3oj3 3oj4 3ons 3phd 3ptf 3zlz 3znh 4uel 4uf6 4whv 4wlr 4wur 4wzp 4xof 4zfr 4zft 4zpz 4zux 5bnb 5caw 5cra 5cvm 5cvn 5cvo 5d0k 5d0m 5dfl 5dk8 5e6j 5edv 5emz 5eya 5gjq 5go7 5go8 5gob 5goc 5god 5gog 5goh 5goi 5goj 5gok 5ibk 5ifr 5j8p 5jbv 5jby 5jg6 5jp3 5jtj 5jtv 5k9p 5kgf 5khy 5l8h 5l8w 5ln1 5lrv 5lrw 5lrx 5m93 5mnj 5n2w 5n38 5nl5 5nlj 5nvg 5tof 5tog 5ulf 5ulh 5ulk 5v1y 5v1z 5vey 5vf0 5w46 5x3m 5x3n 5x3o 5xbo 5xdp 5xk4 5xk5
        UBE2S_HUMAN | Q167631zdn 5bnb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5L9T)