Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STREPTOCOCCAL SURFACE ADHESIN - CSHA NR2
 
Authors :  C. R. Back, P. R. Race, H. F. Jenkinson
Date :  01 Aug 16  (Deposition) - 14 Dec 16  (Release) - 15 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.66
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Streptococcus, Adhesin, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. R. Back, M. N. Sztukowska, M. Till, R. J. Lamont, H. F. Jenkinson, A. H. Nobbs, P. R. Race
The Streptococcus Gordonii Adhesin Csha Protein Binds Host Fibronectin Via A Catch-Clamp Mechanism.
J. Biol. Chem. V. 292 1538 2017
PubMed-ID: 27920201  |  Reference-DOI: 10.1074/JBC.M116.760975

(-) Compounds

Molecule 1 - SURFACE-ASSOCIATED PROTEIN CSHA
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 223-540
    GeneCSHA, SGO_0854
    Organism ScientificSTREPTOCOCCUS GORDONII (STRAIN CHALLIS / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
    Organism Taxid467705
    StrainCHALLIS / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A C 
Biological Unit 2 (1x) B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5L2D)

(-) Sites  (0, 0)

(no "Site" information available for 5L2D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5L2D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5L2D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5L2D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5L2D)

(-) Exons   (0, 0)

(no "Exon" information available for 5L2D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee........ee............eeeeeee..eeeeeeeee..hhhhhhhhhhhhh...hhhhh......ee...................ee.....eeeeeeeeeeeee..ee...eeeeee........eeeeee.....eeeeee....eee.hhhhhhhhhh.....hhhhhh...hhhhh.............ee..eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5l2d A  -1 PMWVDFSDTASMKNLDPQGGFKVGTVFKKEISPGYVVTLTVTELKPFNSTEIYKKRVEGTPTANTYDPNAINSYLKGYKDYGKTPPSVTGRTQIILPDDAVNWGIKFKVEATYRGNPVKPSVVMADGEDANPAEYGIFTTNGEGWEYVGEWMKGPYTVMTEDMVKAFDKTRKDGLLILKDKSVDWSKYLSPDTVTGGLGSQVFGPIISAS 232
                                     8        18        28        38        48        58        68        78        88||     117       127       137       147       157       167 ||    182       192       202       212       222       232
                                                                                                                     89|                                                         169|                                                         
                                                                                                                     109                                                          175                                                         

Chain B from PDB  Type:PROTEIN  Length:211
                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee........ee............eeeeeee..eeeeeeeee..hhhhhhhhhhhhh...hhhhh......ee..............ee....ee.....eeeeeeeeeeeee..eee..eeeeee........eeeeee.....eeeeee.....ee.hhhhhhhhhhh....hhhhhh...hhhhh.............ee..ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l2d B  -1 PMWVDFSDTASMKNLDPQGGFKVGTVFKKEISPGYVVTLTVTELKPFNSTEIYKKRVEGTPTANTYDPNAINSYLKGYKDYGKTPPSVTGRPTQIILPDDAVNWGIKFKVEATYRGNPVKPSVVMADGEDANPAEYGIFTTNGEGWEYVGEWMKGPYTVMTEDMVKAFDKTRKDGLLILKDKSVDWSKYLSPDTVTGGLGSQVFGPIISAS 232
                                     8        18        28        38        48        58        68        78        88 ||    116       126       136       146       156       166  ||   181       191       201       211       221       231 
                                                                                                                      90|                                                         169|                                                         
                                                                                                                      109                                                          175                                                         

Chain C from PDB  Type:PROTEIN  Length:33
                                                                 
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...eeeeeeee....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                 5l2d C 233 KAVPVVMTRGASEVGFYVATGGQQALMMGFLVV 265
                                   242       252       262   

Chain D from PDB  Type:PROTEIN  Length:33
                                                                 
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeeee.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                 5l2d D 233 KAVPVVMTRGASEVGFYVATGGQQALMMGFLVV 265
                                   242       252       262   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5L2D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5L2D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5L2D)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5l2d)
 
  Sites
(no "Sites" information available for 5l2d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5l2d)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5l2d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A8AWJ3_STRGC | A8AWJ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A8AWJ3_STRGC | A8AWJ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5L2D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5L2D)