Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF INTERFERON LAMBDA 1 RECEPTOR WITH HUMAN KINASE JAK1
 
Authors :  J. Lubkowski, A. Wlodawer, D. Zhang
Date :  26 Jul 16  (Deposition) - 12 Oct 16  (Release) - 12 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Complex Of Jak1 And Interferon Lambda 1, Jak Kinase, Intracellular Domain Of Ifnlr1, Ferm Domain, Sh2-Like Domain, Transferase- Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Zhang, A. Wlodawer, J. Lubkowski
Crystal Structure Of A Complex Of The Intracellular Domain Of Interferon Lambda Receptor 1 (Ifnlr1) And The Ferm/Sh2 Domains Of Human Jak1.
J. Mol. Biol. V. 428 4651 2016
PubMed-ID: 27725180  |  Reference-DOI: 10.1016/J.JMB.2016.10.005

(-) Compounds

Molecule 1 - TYROSINE-PROTEIN KINASE JAK1
    ChainsA
    EC Number2.7.10.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cell LineROSETTA 2 (DE3)
    Expression System PlasmidPET-32A(+)
    Expression System Taxid562
    FragmentUNP RESIDUES 31-577
    GeneJAK1, JAK1A, JAK1B
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymJANUS KINASE 1,JAK-1
 
Molecule 2 - INTERFERON LAMBDA RECEPTOR 1
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cell LineROSETTA 2 (DE3)
    Expression System PlasmidPET-32A(+)
    Expression System Taxid562
    FragmentUNP RESIDUES 260-307
    GeneIFNLR1, IL28RA, LICR2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIFN-LAMBDA-R1,CYTOKINE RECEPTOR CLASS-II MEMBER 12,CYTOKINE RECEPTOR FAMILY 2 MEMBER 12,CRF2-12,INTERLEUKIN-28 RECEPTOR SUBUNIT ALPHA,IL-28RA,LIKELY INTERLEUKIN OR CYTOKINE RECEPTOR 2,LICR2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5L04)

(-) Sites  (0, 0)

(no "Site" information available for 5L04)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5L04)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5L04)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5L04)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5L04)

(-) Exons   (0, 0)

(no "Exon" information available for 5L04)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:460
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee........eee..eeeehhhhhhhhhhhh.....hhh.eeeee....ee.....eeee.....eeeeeee.................ee.......eehhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....eeeee..eee........eeeeee...eeeeee....eeeehhh.eeeeeee..eeeeee....eeeee..hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh.ee...hhhhhhhhhhhhh.....eeeee......eeeeeeeee...eeeeeeeeeee..eeee........hhhhhhhhhhheeeee..eee.................eehhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l04 A  35 GVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPESYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSEGNVLYYEVMVTGNLGIQWRHKPEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQE 563
                                    44        54        64        74        84        94       104       114       124      |148       158       168       178       188       198       208 ||    223       233       243       253       263       273       283       293  ||   314       324    || 366       376       386       396       406       416       426       436       446       456       466       476       493       503       513       523       533       543       553       563
                                                                                                                          131|                                                             210|                                                                             296|                  329|                                                                                                                       484|                                                                       
                                                                                                                           146                                                              216                                                                              308                   362                                                                                                                        492                                                                       

Chain B from PDB  Type:PROTEIN  Length:37
                                                                     
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh.........ee...........eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 5l04 B 261 AKMPRALDFSGHTHPVATFQPSRPESVNDLFLCPQKE 297
                                   270       280       290       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5L04)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5L04)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5L04)

(-) Gene Ontology  (52, 54)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5l04)
 
  Sites
(no "Sites" information available for 5l04)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5l04)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5l04
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  INLR1_HUMAN | Q8IU57
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  JAK1_HUMAN | P23458
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  INLR1_HUMAN | Q8IU57
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  JAK1_HUMAN | P23458
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        INLR1_HUMAN | Q8IU573og4 3og6 5ixd 5ixi 5t5w
        JAK1_HUMAN | P234583eyg 3eyh 4e4l 4e4n 4e5w 4ehz 4ei4 4fk6 4gs0 4i5c 4ivb 4ivc 4ivd 4k6z 4k77 4l00 4l01 5e1e 5hx8 5ixd 5ixi 5khw 5khx

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5L04)