Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HUMAN CYCLOPHILIN A AT 278K, DATA SET 3
 
Authors :  S. Russi, A. Gonzalez, L. R. Kenner, D. A. Keedy, J. S. Fraser, H. Van Den
Date :  13 Jul 16  (Deposition) - 10 Aug 16  (Release) - 11 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Conformational Variation, Radiation Damage, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Russi, A. Gonzalez, L. R. Kenner, D. A. Keedy, J. S. Fraser, H. Van Den Bedem
Conformational Variation Of Proteins At Room Temperature Is Not Dominated By Radiation Damage.
J Synchrotron Radiat V. 24 73 2017
PubMed-ID: 28009548  |  Reference-DOI: 10.1107/S1600577516017343

(-) Compounds

Molecule 1 - PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
    ChainsA
    EC Number5.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GenePPIA, CYPA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPPIASE A,CYCLOPHILIN A,CYCLOSPORIN A-BINDING PROTEIN, ROTAMASE A

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5KV1)

(-) Sites  (0, 0)

(no "Site" information available for 5KV1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KV1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5KV1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KV1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KV1)

(-) Exons   (0, 0)

(no "Exon" information available for 5KV1)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:164
                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee..eeeeeeeeee....hhhhhhhhhhhhhh............eee...eeee................................eeee...........eeee...hhhhh....eeeeeeehhhhhhhhhh...........eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kv1 A   2 VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE 165
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KV1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KV1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KV1)

(-) Gene Ontology  (30, 30)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5kv1)
 
  Sites
(no "Sites" information available for 5kv1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5kv1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kv1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PPIA_HUMAN | P62937
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PPIA_HUMAN | P62937
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PPIA_HUMAN | P629371ak4 1awq 1awr 1aws 1awt 1awu 1awv 1bck 1cwa 1cwb 1cwc 1cwf 1cwh 1cwi 1cwj 1cwk 1cwl 1cwm 1cwo 1fgl 1m63 1m9c 1m9d 1m9e 1m9f 1m9x 1m9y 1mf8 1mik 1nmk 1oca 1rmh 1vbs 1vbt 1w8l 1w8m 1w8v 1ynd 1zkf 2alf 2cpl 2cyh 2ms4 2mzu 2n0t 2rma 2rmb 2x25 2x2a 2x2c 2x2d 2xgy 3cyh 3cys 3k0m 3k0n 3k0o 3k0p 3k0q 3k0r 3odi 3odl 3rdd 4cyh 4ipz 4n1m 4n1n 4n1o 4n1p 4n1q 4n1r 4n1s 4yug 4yuh 4yui 4yuj 4yuk 4yul 4yum 4yun 4yuo 4yup 5cyh 5f66 5fjb 5kul 5kun 5kuo 5kuq 5kur 5kus 5kuu 5kuv 5kuw 5kuz 5kv0 5kv2 5kv3 5kv4 5kv5 5kv6 5kv7 5lud 5noq 5nor 5nos 5not 5nou 5nov 5now 5nox 5noy 5noz 5t9u 5t9w 5t9z 5ta2 5ta4

(-) Related Entries Specified in the PDB File

5kul 5kun 5kuo 5kuq 5kur 5kus 5kuu 5kuv 5kuw 5kuz 5kv0 5kv2 5kv3 5kv4 5kv5 5kv6 5kv7