Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  TRYPANOSOME BRUCEI HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANFERASE IN COMPLEX WITH INOSINE 5' MONOPHOSPHATE
 
Authors :  D. Teran, L. Guddat
Date :  01 Jun 16  (Deposition) - 09 Nov 16  (Release) - 09 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.48
Chains :  Asym. Unit :  A,C
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  C  (2x)
Keywords :  Inhibitor, Complex, Dimer, Enzyme, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Teran, D. Hockova, M. Cesnek, A. Zikova, L. Naesens, D. T. Keough, L. W. Guddat
Crystal Structures And Inhibition Of Trypanosoma Brucei Hypoxanthine-Guanine Phosphoribosyltransferase.
Sci Rep V. 6 35894 2016
PubMed-ID: 27786284  |  Reference-DOI: 10.1038/SREP35894

(-) Compounds

Molecule 1 - HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    Chains: A, C
    EC Number: 2.4.2.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: HGPRT
    Organism Scientific: TRYPANOSOMA BRUCEI BRUCEI
    Organism Taxid: 5702
    Synonym: HGPRTASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AC
Biological Unit 1 (2x): A 
Biological Unit 2 (2x):  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 11)

Asymmetric Unit (3, 11)
No.NameCountTypeFull Name
1IMP2Ligand/IonINOSINIC ACID
2MG5Ligand/IonMAGNESIUM ION
3SO44Ligand/IonSULFATE ION
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
1IMP2Ligand/IonINOSINIC ACID
2MG-1Ligand/IonMAGNESIUM ION
3SO44Ligand/IonSULFATE ION
Biological Unit 2 (2, 6)
No.NameCountTypeFull Name
1IMP2Ligand/IonINOSINIC ACID
2MG-1Ligand/IonMAGNESIUM ION
3SO44Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREILE A:115 , LYS A:145 , VAL A:165 , PHE A:166 , VAL A:167 , ASP A:173 , SO4 A:3302 , SO4 A:3303 , MG A:3304 , HOH A:3402binding site for residue IMP A 3301
02AC2SOFTWARELYS A:54 , GLY A:55 , ASP A:173 , ARG A:179 , IMP A:3301 , MG A:3305binding site for residue SO4 A 3302
03AC3SOFTWAREASP A:117 , THR A:118 , ALA A:119 , THR A:121 , IMP A:3301binding site for residue SO4 A 3303
04AC4SOFTWAREGLU A:113 , ASP A:114 , IMP A:3301binding site for residue MG A 3304
05AC5SOFTWAREASP A:173 , SO4 A:3302 , HOH A:3402binding site for residue MG A 3305
06AC6SOFTWAREILE C:115 , ASP C:117 , LYS C:145 , PHE C:166 , VAL C:167 , ASP C:173 , SO4 C:302 , SO4 C:303 , MG C:304 , MG C:305binding site for residue IMP C 301
07AC7SOFTWARELEU C:116 , ASP C:117 , THR C:118 , ALA C:119 , LEU C:120 , THR C:121 , IMP C:301binding site for residue SO4 C 302
08AC8SOFTWARELYS C:54 , GLY C:55 , ARG C:80 , ASP C:173 , ARG C:179 , IMP C:301 , MG C:304 , MG C:306binding site for residue SO4 C 303
09AC9SOFTWAREIMP C:301 , SO4 C:303 , MG C:306binding site for residue MG C 304
10AD1SOFTWAREGLU C:113 , ASP C:114 , IMP C:301binding site for residue MG C 305
11AD2SOFTWAREASP C:173 , SO4 C:303 , MG C:304binding site for residue MG C 306

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KAM)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Leu A:53 -Lys A:54
2Leu C:53 -Lys C:54

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KAM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KAM)

(-) Exons   (0, 0)

(no "Exon" information available for 5KAM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:158
                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeehhhhhhhhhhhhhhhhhhhh...........eeeeee..hhhhhhhhhhhhhhhh...eeeeee....eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.hhhh.......eeeee.....ee...............eee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kam A  11 TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY 192
                                    20        30        40        50        60        70        80|      114       124       134       144       154       164       174       184        
                                                                                                80|                                                                                       
                                                                                                105                                                                                       


Chain C from PDB  Type:PROTEIN  Length:172
                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeehhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee..hhhhhhhhhhhhhhhh...eeeeee.....eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.hhhh.......eeeee.....ee...............eeeehhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kam C   5 CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL 199
                                    14        24        34        44        54        64        74     ||107       117       127       137       147       157       167       177       187       197  
                                                                                                      80|                                                                                               
                                                                                                      104
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KAM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KAM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KAM)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:53 - Lys A:54   [ RasMol ]  
    Leu C:53 - Lys C:54   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kam
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HPRT_TRYBB | Q07010
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HPRT_TRYBB | Q07010
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HPRT_TRYBB | Q07010: 5jsq 5jv5 5k51 5kap

(-) Related Entries Specified in the PDB File

5jsq 5jv5 5k51 5kap