Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  EFFICIENT TARGETING OF THE ASIALOGLYCOPROTEIN RECEPTOR BY POLYVALENT DISPLAY OF A COMPACT GALACTOSEAMINE MIMIC
 
Authors :  S. Liu
Date :  04 May 16  (Deposition) - 14 Jun 17  (Release) - 14 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Asialoglycoprotein Receptor, Carbohydrates, Liver Targeting, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. A. Sanhueza, M. M. Baksh, B. Thuma, M. D. Roy, S. Dutta, C. Preville, B. A. Chrunyk, K. Beaumont, R. Dullea, M. Ammirati, S. Liu, D. Gebhard, J. E. Finley, C. T. Salatto, A. King-Ahmad, I. Stock, K. Atkinson, B. Reidich, W. Lin, R. Kumar, M. Tu, E. Menhaji-Klotz, D. A. Price, S. Liras, M. G. Finn, V. Mascitti
Efficient Liver Targeting By Polyvalent Display Of A Compac Ligand For The Asialoglycoprotein Receptor.
J. Am. Chem. Soc. V. 139 3528 2017
PubMed-ID: 28230359  |  Reference-DOI: 10.1021/JACS.6B12964

(-) Compounds

Molecule 1 - ASIALOGLYCOPROTEIN RECEPTOR 1
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI-PICHIA PASTORIS SHUTTLE VECTOR PPPARG4
    Expression System Taxid1182032
    GeneASGR1, CLEC4H1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymASGPR 1,C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER H1,HEPATIC LECTIN H1,HL-1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 9)

Asymmetric/Biological Unit (3, 9)
No.NameCountTypeFull Name
1CA6Ligand/IonCALCIUM ION
2CL1Ligand/IonCHLORIDE ION
3LBT2Ligand/IonALPHA-LACTOSE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:236 , GLN A:239 , ASP A:241 , TRP A:243 , GLU A:252 , ASN A:264 , ASP A:265 , CA A:303 , HOH A:404 , HOH A:480 , HOH A:490binding site for residue LBT A 301
2AC2SOFTWAREASP A:215 , ASP A:242 , GLU A:252 , ASP A:253 , HOH A:441 , HOH A:488 , HOH A:497binding site for residue CA A 302
3AC3SOFTWAREGLN A:239 , ASP A:241 , GLU A:252 , ASN A:264 , ASP A:265 , LBT A:301binding site for residue CA A 303
4AC4SOFTWAREVAL A:190 , GLU A:196 , GLU A:277 , HOH A:428 , HOH A:448 , HOH A:493binding site for residue CA A 304
5AC5SOFTWAREARG A:270 , HOH A:506 , ARG B:270 , HOH B:509binding site for residue CL A 305
6AC6SOFTWAREARG B:236 , GLN B:239 , ASP B:241 , GLU B:252 , ASN B:264 , ASP B:265 , CA B:303 , HOH B:408 , HOH B:413 , HOH B:484 , HOH B:490 , HOH B:502binding site for residue LBT B 301
7AC7SOFTWAREASP B:215 , ASP B:242 , GLU B:252 , ASP B:253 , HOH B:434 , HOH B:497 , HOH B:500binding site for residue CA B 302
8AC8SOFTWAREGLN B:239 , ASP B:241 , GLU B:252 , ASN B:264 , ASP B:265 , LBT B:301binding site for residue CA B 303
9AC9SOFTWAREVAL B:190 , GLU B:196 , GLU B:277 , HOH B:421 , HOH B:485 , HOH B:505binding site for residue CA B 304

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:153 -A:164
2A:181 -A:276
3A:254 -A:268
4B:153 -B:164
5B:181 -B:276
6B:254 -B:268

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gln A:239 -Pro A:240
2Gln B:239 -Pro B:240

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JPV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JPV)

(-) Exons   (0, 0)

(no "Exon" information available for 5JPV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeee......ee...............................eeee.....eeee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jpv A 153 CPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETEL 280
                                   162       172       182       192       202       212       222       232       242       252       262       272        

Chain B from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeee......ee...............................eeee.....eeee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jpv B 153 CPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETEL 280
                                   162       172       182       192       202       212       222       232       242       252       262       272        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JPV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JPV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JPV)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LBT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:239 - Pro A:240   [ RasMol ]  
    Gln B:239 - Pro B:240   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jpv
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ASGR1_HUMAN | P07306
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ASGR1_HUMAN | P07306
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ASGR1_HUMAN | P073061dv8 5jq1

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5JPV)