Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN IZUMO1-JUNO COMPLEX (CRYSTAL FORM 1)
 
Authors :  U. Ohto, H. Ishida, T. Shimizu
Date :  26 Apr 16  (Deposition) - 22 Jun 16  (Release) - 29 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Fertilization, Izumo1, Juno, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  U. Ohto, H. Ishida, E. Krayukhina, S. Uchiyama, N. Inoue, T. Shimizu
Structure Of Izumo1-Juno Reveals Sperm-Oocyte Recognition During Mammalian Fertilization
Nature V. 534 566 2016
PubMed-ID: 27309808  |  Reference-DOI: 10.1038/NATURE18596

(-) Compounds

Molecule 1 - IZUMO SPERM-EGG FUSION PROTEIN 1
    ChainsA
    EngineeredYES
    Expression SystemDROSOPHILA
    Expression System Taxid7215
    FragmentUNP RESIDUES 22-255
    GeneIZUMO1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymOOCYTE BINDING/FUSION FACTOR,OBF,SPERM-SPECIFIC PROTEIN IZUMO
 
Molecule 2 - SPERM-EGG FUSION PROTEIN JUNO
    ChainsB
    EngineeredYES
    Expression SystemDROSOPHILA
    Expression System Taxid7215
    FragmentUNP RESIDUES 20-228
    GeneIZUMO1R, FOLR4, JUNO
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFOLATE RECEPTOR 4,FOLATE RECEPTOR DELTA,FR-DELTA,IZUMO1 RECEPTOR PROTEIN JUNO

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP B:50 , SER B:100 , ASN B:102 , ASN B:217 , ASN B:219binding site for residue CL B 302
2AC2SOFTWAREASN A:204binding site for Mono-Saccharide NAG A 300 bound to ASN A 204
3AC3SOFTWARELYS B:31 , PRO B:70 , LEU B:71 , ASN B:73binding site for Mono-Saccharide NAG B 301 bound to ASN B 73

(-) SS Bonds  (13, 13)

Asymmetric/Biological Unit
No.Residues
1A:22 -A:149
2A:25 -A:152
3A:135 -A:159
4A:139 -A:165
5A:182 -A:233
6B:27 -B:55
7B:47 -B:95
8B:56 -B:99
9B:79 -B:172
10B:86 -B:143
11B:132 -B:206
12B:136 -B:186
13B:149 -B:166

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JKC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JKC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JKC)

(-) Exons   (0, 0)

(no "Exon" information available for 5JKC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:233
                                                                                                                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eehhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeee.....eeeeeee.......eeeeee....eeee..hhhhhhh..eeeeeeeee.....eeeeeee...eeee...hhhhheeeeeeeee......eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jkc A  18 RSPWCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLP 254
                                    27        37        47        57        67|       81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251   
                                                                            67|                                                                                                                                                                                      
                                                                             72                                                                                                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:201
                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...................hhhhhhhh.....hhhhhhhhh..........hhhhh..hhhhhhhhhhhhhhhhhh..hhh.ee....ee..eeehhhhhhhhhhhhh..ee........................eehhhhh.hhhhhhhhh....eee...............hhhhh..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jkc B  18 PWGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASEF 230
                                    27        37        47        57        67        77        87        97       107  ||   129       139       149       159       169       179       189       199       209       219       229 
                                                                                                                      110|                                                                                                           
                                                                                                                       123                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JKC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JKC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JKC)

(-) Gene Ontology  (15, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jkc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jkc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IZUM1_HUMAN | Q8IYV9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  JUNO_HUMAN | A6ND01
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IZUM1_HUMAN | Q8IYV9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  JUNO_HUMAN | A6ND01
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IZUM1_HUMAN | Q8IYV95f4e 5f4t 5f4v 5jk9 5jkd 5jke
        JUNO_HUMAN | A6ND015f4e 5f4q 5jka 5jkb 5jkd 5jke

(-) Related Entries Specified in the PDB File

5jk9 5jka 5jkb 5jkd 5jke