Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CENTRAL DOMAIN OF HUMAN AKAP18 GAMMA/DELTA IN COMPLEX WITH MALONATE
 
Authors :  K. Bjerregaard-Andersen, E. Ostensen, J. D. Scott, K. Tasken, J. P. Mor
Date :  22 Apr 16  (Deposition) - 03 Aug 16  (Release) - 17 Aug 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.25
Chains :  Asym./Biol. Unit :  A
Keywords :  Akap, A-Kinase Anchoring, Phospoesterase, Malonate, Complex, Central Domain, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Bjerregaard-Andersen, E. Stensen, J. D. Scott, K. Tasken, J. P. Morth
Malonate In The Nucleotide-Binding Site Traps Human Akap18 Gamma / Delta In A Novel Conformational State.
Acta Crystallogr. , Sect. F V. 72 591 2016
PubMed-ID: 27487922  |  Reference-DOI: 10.1107/S2053230X16010189

(-) Compounds

Molecule 1 - A-KINASE ANCHOR PROTEIN 7 ISOFORM GAMMA
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET-46 EK/LIC
    Expression System Taxid469008
    Expression System VariantCODONPLUS
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 76-286
    GeneAKAP7, AKAP18
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAKAP-7 ISOFORM GAMMA,A-KINASE ANCHOR PROTEIN 18 KDA,AKAP 18, PROTEIN KINASE A-ANCHORING PROTEIN 7 ISOFORM GAMMA,PRKA7 ISOFORM GAMMA

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MLI6Ligand/IonMALONATE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:127 , THR A:129 , ARG A:214 , HIS A:219 , THR A:221 , MLI A:302 , HOH A:435 , HOH A:440 , HOH A:518 , HOH A:547binding site for residue MLI A 301
2AC2SOFTWAREHIS A:127 , THR A:129 , TYR A:275 , MLI A:301 , HOH A:402 , HOH A:437binding site for residue MLI A 302
3AC3SOFTWAREVAL A:121 , SER A:122 , SER A:125 , LYS A:224 , LYS A:227 , LYS A:269 , TYR A:275binding site for residue MLI A 303
4AC4SOFTWAREASN A:86 , ILE A:104 , LYS A:246 , PHE A:247 , LEU A:266 , HOH A:401 , HOH A:433 , HOH A:494 , HOH A:578binding site for residue MLI A 304
5AC5SOFTWAREGLU A:97 , LYS A:100 , HOH A:402binding site for residue MLI A 305
6AC6SOFTWAREARG A:76 , GLU A:194binding site for residue MLI A 306

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JJ2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JJ2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JJ2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JJ2)

(-) Exons   (0, 0)

(no "Exon" information available for 5JJ2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:211
                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh...eeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeeee...eeeeee..hhhhhhhhhhhhhhhhhhhhh..ee........eeeeee...hhhhhh......hhhhhhhhh..eeeeee..eeeeee............eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jj2 A  76 RKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESSIVIGEK 286
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JJ2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JJ2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JJ2)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MLI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jj2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jj2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AKA7G_HUMAN | Q9P0M2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AKA7G_HUMAN | Q9P0M2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AKA7G_HUMAN | Q9P0M24zp3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5JJ2)