Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  RAB11 BOUND TO MYOVA-GTD
 
Authors :  O. Pylypenko, W. Attanda, C. Gauquelin, G. Malherbes, A. Houdusse
Date :  15 Apr 16  (Deposition) - 28 Sep 16  (Release) - 28 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.06
Chains :  Asym. Unit :  A,B,C,D,E,I
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,I  (1x)
Keywords :  Myosin, Complex, Rab, Motor Cargo Recognition, Motor Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  O. Pylypenko, T. Welz, J. Tittel, M. Kollmar, F. Chardon, G. Malherbe, S. Weiss, C. I. Michel, A. Samol-Wolf, A. T. Grasskamp, A. Hume, B. Goud B. Baron, P. England, M. A. Titus, P. Schwille, T. Weidemann, A. Houdusse, E. Kerkhoff
Coordinated Recruitment Of Spir Actin Nucleators And Myosin V Motors To Rab11 Vesicle Membranes.
Elife V. 5 2016
PubMed-ID: 27623148  |  Reference-DOI: 10.7554/ELIFE.17523

(-) Compounds

Molecule 1 - RAS-RELATED PROTEIN RAB-11A
    ChainsA, D, I
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System Taxid469008
    GeneRAB11A, RAB11
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymRAB-11,YL8
 
Molecule 2 - UNCONVENTIONAL MYOSIN-VA
    ChainsB, C, E
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System Taxid469008
    FragmentUNP RESIDUES 1437-1828
    GeneMYO5A, MYH12
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDILUTE MYOSIN HEAVY CHAIN,NON-MUSCLE,MYOSIN HEAVY CHAIN 12, MYOSIN-12,MYOXIN

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEI
Biological Unit 1 (1x)AB    
Biological Unit 2 (1x)  CD  
Biological Unit 3 (1x)    EI

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 27)

Asymmetric Unit (6, 27)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2BEF3Ligand/IonBERYLLIUM TRIFLUORIDE ION
3EDO13Ligand/Ion1,2-ETHANEDIOL
4GDP3Ligand/IonGUANOSINE-5'-DIPHOSPHATE
5GOL2Ligand/IonGLYCEROL
6MG4Ligand/IonMAGNESIUM ION
Biological Unit 1 (5, 10)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2BEF1Ligand/IonBERYLLIUM TRIFLUORIDE ION
3EDO5Ligand/Ion1,2-ETHANEDIOL
4GDP1Ligand/IonGUANOSINE-5'-DIPHOSPHATE
5GOL2Ligand/IonGLYCEROL
6MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (4, 9)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2BEF1Ligand/IonBERYLLIUM TRIFLUORIDE ION
3EDO6Ligand/Ion1,2-ETHANEDIOL
4GDP1Ligand/IonGUANOSINE-5'-DIPHOSPHATE
5GOL-1Ligand/IonGLYCEROL
6MG-1Ligand/IonMAGNESIUM ION
Biological Unit 3 (3, 4)
No.NameCountTypeFull Name
1ACT-1Ligand/IonACETATE ION
2BEF1Ligand/IonBERYLLIUM TRIFLUORIDE ION
3EDO2Ligand/Ion1,2-ETHANEDIOL
4GDP1Ligand/IonGUANOSINE-5'-DIPHOSPHATE
5GOL-1Ligand/IonGLYCEROL
6MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (48, 48)

Asymmetric Unit (48, 48)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:25 , THR A:43 , GDP A:202 , BEF A:203 , HOH A:316 , HOH A:326binding site for residue MG A 201
02AC2SOFTWAREGLY A:21 , VAL A:22 , GLY A:23 , LYS A:24 , SER A:25 , ASN A:26 , PHE A:36 , ASN A:37 , LEU A:38 , SER A:40 , ASN A:124 , LYS A:125 , ASP A:127 , LEU A:128 , SER A:154 , ALA A:155 , LEU A:156 , MG A:201 , BEF A:203 , HOH A:308 , HOH A:316 , HOH A:326 , HOH A:336binding site for residue GDP A 202
03AC3SOFTWARESER A:20 , LYS A:24 , SER A:42 , THR A:43 , ALA A:68 , GLY A:69 , MG A:201 , GDP A:202 , HOH A:316 , HOH A:326 , HOH A:431binding site for residue BEF A 203
04AC4SOFTWAREILE A:17 , GLY A:18 , THR A:67 , ARG A:72 , TRP A:105 , GLU A:108binding site for residue EDO A 204
05AC5SOFTWAREARG A:129 , ARG A:132 , HOH A:399 , CYS C:1674binding site for residue EDO A 205
06AC6SOFTWARETYR A:99 , GLU A:100 , VAL A:102 , GLU A:103 , PHE A:142 , HOH A:357binding site for residue EDO A 206
07AC7SOFTWAREARG A:140 , ILE A:151 , GLU A:152 , ASN A:160binding site for residue ACT A 207
08AC8SOFTWARETYR A:10 , LEU A:11binding site for residue GOL A 208
09AC9SOFTWARETYR B:1692 , GLY B:1695 , ALA B:1696 , THR B:1741 , LEU B:1742 , PRO B:1744 , LEU B:1745 , MET B:1817binding site for residue EDO B 1901
10AD1SOFTWAREHOH A:412 , GLU B:1725 , GLU B:1726 , ARG B:1729 , HOH B:2046binding site for residue EDO B 1902
11AD2SOFTWAREGLU A:47 , ARG B:1718 , GLU B:1725 , LYS B:1739 , GLU B:1743binding site for residue GOL B 1903
12AD3SOFTWARETYR C:1692 , GLY C:1695 , ALA C:1696 , THR C:1741 , LEU C:1742 , PRO C:1744 , LEU C:1745 , MET C:1817 , HOH C:2080binding site for residue EDO C 1901
13AD4SOFTWARELEU C:1752 , GLN C:1753 , VAL C:1754 , LYS C:1756 , TYR C:1784 , TYR D:73binding site for residue EDO C 1902
14AD5SOFTWARELEU C:1491 , LYS C:1540 , LYS C:1544binding site for residue EDO C 1903
15AD6SOFTWAREGLU C:1681 , THR C:1826 , PRO C:1828 , HOH C:2168 , HOH C:2241binding site for residue EDO C 1904
16AD7SOFTWAREARG C:1807 , ARG C:1809 , ASN E:1590 , HOH E:2091 , HOH E:2096binding site for residue MG C 1905
17AD8SOFTWAREGLN C:1840binding site for residue ACT C 1906
18AD9SOFTWARESER D:25 , THR D:43 , GDP D:202 , BEF D:203 , HOH D:309 , HOH D:326binding site for residue MG D 201
19AE1SOFTWAREGLY D:21 , VAL D:22 , GLY D:23 , LYS D:24 , SER D:25 , ASN D:26 , PHE D:36 , ASN D:37 , LEU D:38 , SER D:40 , ASN D:124 , LYS D:125 , ASP D:127 , LEU D:128 , SER D:154 , ALA D:155 , LEU D:156 , MG D:201 , BEF D:203 , HOH D:309 , HOH D:322 , HOH D:326 , HOH D:333binding site for residue GDP D 202
20AE2SOFTWARESER D:20 , LYS D:24 , SER D:42 , THR D:43 , ALA D:68 , GLY D:69 , MG D:201 , GDP D:202 , HOH D:309 , HOH D:326binding site for residue BEF D 203
21AE3SOFTWARETYR D:99 , GLU D:100 , VAL D:102 , GLU D:103 , PHE D:142 , HOH D:343binding site for residue EDO D 204
22AE4SOFTWAREILE D:17 , GLY D:18 , THR D:67 , ARG D:72 , TRP D:105 , GLU D:108binding site for residue EDO D 205
23AE5SOFTWARETYR E:1692 , GLY E:1695 , ALA E:1696 , THR E:1741 , LEU E:1742 , PRO E:1744 , LEU E:1745 , MET E:1817 , HOH E:2014binding site for residue EDO E 1901
24AE6SOFTWARELYS E:1779 , ASN E:1782binding site for residue EDO E 1902
25AE7SOFTWARESER I:25 , THR I:43 , GDP I:202 , BEF I:203 , HOH I:301 , HOH I:303binding site for residue MG I 201
26AE8SOFTWAREGLY I:21 , VAL I:22 , GLY I:23 , LYS I:24 , SER I:25 , ASN I:26 , ASN I:34 , PHE I:36 , ASN I:37 , LEU I:38 , SER I:40 , ASN I:124 , LYS I:125 , ASP I:127 , SER I:154 , ALA I:155 , LEU I:156 , MG I:201 , BEF I:203 , HOH I:301 , HOH I:303 , HOH I:307binding site for residue GDP I 202
27AE9SOFTWARESER I:20 , LYS I:24 , SER I:42 , THR I:43 , ALA I:68 , GLY I:69 , MG I:201 , GDP I:202 , HOH I:303binding site for residue BEF I 203
28AF1SOFTWAREARG I:33 , ASN I:34 , GLU I:35 , LYS I:125 , SER I:126 , ARG I:129 , SER I:154 , ASP I:157 , GDP I:202binding site for Ligand ASP I 127 bound to ASN I 34
29AF2SOFTWAREARG I:33 , ASN I:34 , GLU I:35 , LYS I:125 , SER I:126 , ARG I:129 , SER I:154 , ASP I:157 , GDP I:202binding site for Ligand ASP I 127 bound to ASN I 34
30AF3SOFTWAREARG I:30 , ASN I:34 , GLU I:35 , ASN I:124 , SER I:126 , ASP I:127 , THR I:153 , ALA I:155 , LEU I:156 , ASP I:157 , SER I:158 , THR I:159 , VAL I:161 , GDP I:202binding site for Ligand SER I 154 bound to ASN I 34
31AF4SOFTWAREARG I:30 , ASN I:34 , GLU I:35 , ASN I:124 , SER I:126 , ASP I:127 , THR I:153 , ALA I:155 , LEU I:156 , ASP I:157 , SER I:158 , THR I:159 , VAL I:161 , GDP I:202binding site for Ligand SER I 154 bound to ASN I 34
32AF5SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
33AF6SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
34AF7SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
35AF8SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
36AF9SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
37AG1SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
38AG2SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
39AG3SOFTWAREILE I:151 , GLU I:152 , THR I:153 , THR I:159 , ASN I:160 , VAL I:161 , ALA I:163 , ALA I:164 , PHE I:165 , GLN I:166binding site for Ligand GLU I 162 bound to ASN I 160
40AG4SOFTWAREASN I:26 , LEU I:27 , LEU I:28 , SER I:29 , PHE I:31 , THR I:32 , ASN I:34 , GLU I:35 , PHE I:36 , THR I:153 , SER I:154 , ALA I:155 , LEU I:156 , ASP I:157 , SER I:158 , ASN I:160 , VAL I:161 , GLU I:162binding site for Di-peptide ARG I 30 and THR I 159
41AG5SOFTWAREASN I:26 , LEU I:27 , LEU I:28 , SER I:29 , PHE I:31 , THR I:32 , ARG I:33 , ASN I:34 , GLU I:35 , PHE I:36 , ASP I:127 , SER I:154 , ALA I:155 , LEU I:156 , SER I:158 , THR I:159binding site for Di-peptide ARG I 30 and ASP I 157
42AG6SOFTWAREASN I:26 , LEU I:27 , LEU I:28 , SER I:29 , PHE I:31 , THR I:32 , ASN I:34 , GLU I:35 , PHE I:36 , THR I:153 , SER I:154 , ALA I:155 , LEU I:156 , ASP I:157 , SER I:158 , ASN I:160 , VAL I:161 , GLU I:162binding site for Di-peptide ARG I 30 and THR I 159
43AG7SOFTWAREASN I:26 , LEU I:27 , LEU I:28 , SER I:29 , PHE I:31 , THR I:32 , ARG I:33 , ASN I:34 , GLU I:35 , PHE I:36 , ASP I:127 , SER I:154 , ALA I:155 , LEU I:156 , SER I:158 , THR I:159binding site for Di-peptide ARG I 30 and ASP I 157
44AG8SOFTWAREASN I:26 , LEU I:27 , LEU I:28 , SER I:29 , PHE I:31 , THR I:32 , ASN I:34 , GLU I:35 , PHE I:36 , SER I:154 , ALA I:155 , ASP I:157 , SER I:158 , THR I:159 , GDP I:202binding site for Di-peptide ARG I 30 and LEU I 156
45AG9SOFTWAREASN I:26 , LEU I:27 , LEU I:28 , SER I:29 , PHE I:31 , THR I:32 , ARG I:33 , ASN I:34 , GLU I:35 , PHE I:36 , ASP I:127 , SER I:154 , ALA I:155 , LEU I:156 , SER I:158 , THR I:159binding site for Di-peptide ARG I 30 and ASP I 157
46AH1SOFTWARELEU I:27 , LEU I:28 , SER I:29 , ARG I:30 , THR I:32 , ARG I:33 , ASN I:34 , THR I:153 , SER I:154 , ASP I:157 , SER I:158 , ASN I:160 , VAL I:161 , GLU I:162 , PHE I:165binding site for Di-peptide PHE I 31 and THR I 159
47AH2SOFTWARELEU I:27 , LEU I:28 , SER I:29 , ARG I:30 , THR I:32 , ARG I:33 , ASN I:34 , THR I:153 , SER I:154 , ASP I:157 , SER I:158 , ASN I:160 , VAL I:161 , GLU I:162 , PHE I:165binding site for Di-peptide PHE I 31 and THR I 159
48AH3SOFTWAREASN I:26 , SER I:29 , ARG I:30 , PHE I:31 , ARG I:33 , ASN I:34 , PHE I:36 , ASP I:127 , SER I:154 , ALA I:155 , LEU I:156 , SER I:158 , THR I:159binding site for Di-peptide GLU I 35 and ASP I 157

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JCZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JCZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JCZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JCZ)

(-) Exons   (0, 0)

(no "Exon" information available for 5JCZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:172
                                                                                                                                                                                                             
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee.....hhhhhhhhhhhh...........eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5jcz A    6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVS  177
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175  

Chain B from PDB  Type:PROTEIN  Length:364
                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.hhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhh...hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhh..........hhhhhhhhhhhh............................hhhhh..hhhhh....eee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5jcz B 1471 FQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV 1853
                                  1480      1490      1500      1510      1520      1530      1540      1550      1560      1570      1580      1590      1600      1610      1620      1630    ||1659      1669      1679      1689      1699      1709      1719      1729      1739      1749      1759      1769      1779      1789      1799      1809      1819      1829      1839      1849    
                                                                                                                                                                                             1635|                                                                                                                                                                                                      
                                                                                                                                                                                              1655                                                                                                                                                                                                      

Chain C from PDB  Type:PROTEIN  Length:364
                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee.hhhhhhhhhhhhh.......hhhhh..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhh...hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhh..........hhhhhhhhhhhhhhh.........................hhhhh..hhhhh....eee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5jcz C 1469 KDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV 1853
                                  1478      1488      1498      1508      1518      1528      1538      1548      1558      1568      1578      1588      1598      1608      1618      1628     |1659      1669      1679      1689      1699      1709      1719      1729      1739      1749      1759      1769      1779      1789      1799      1809      1819      1829      1839      1849    
                                                                                                                                                                                              1634|                                                                                                                                                                                                     
                                                                                                                                                                                               1656                                                                                                                                                                                                     

Chain D from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                              
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeee.....hhhhhhhhhhhh...........eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5jcz D    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVS  177
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174   

Chain E from PDB  Type:PROTEIN  Length:361
                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.hhhhhhhhhhhhh......hhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhh...hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhh..........hhhhhhhhhhhhhhh.........................hhhhh..hhhhh....eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5jcz E 1471 FQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV 1853
                                  1480      1490      1500      1510      1520      1530      1540      1550      1560      1570      1580      1590      1600      1610      1620      1630 ||   1662      1672      1682      1692      1702      1712      1722      1732      1742      1752      1762      1772      1782      1792      1802      1812      1822      1832      1842      1852 
                                                                                                                                                                                          1632|                                                                                                                                                                                                      
                                                                                                                                                                                           1655                                                                                                                                                                                                      

Chain I from PDB  Type:PROTEIN  Length:147
                                                                                                                                                                                    
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhh...........eeee..eeeeee......hhhhhhh...eeeeee..hhhhhhhhhhhhhhhhhhh...eeeeee.........hhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5jcz I   11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKAQIWDTAGQERAITSAYYRGAGALLVYDIAKHLTYENVERWLKELRDHADSVIMLVGNKSDRHLRAVPTEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYR  174
                                    20        30        40        50|       70 ||     82 ||     93       103       113 ||    125 ||    136|      147       157       167       
                                                                  50|         72|       84|                          115|      127|    136|                                    
                                                                   61          75        86                           118       129     138                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JCZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JCZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JCZ)

(-) Gene Ontology  (106, 119)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BEF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jcz)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jcz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MYO5A_HUMAN | Q9Y4I1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RB11A_HUMAN | P62491
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MYO5A_HUMAN | Q9Y4I1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RB11A_HUMAN | P62491
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MYO5A_HUMAN | Q9Y4I14d07 4j5l 4lli 4lx1 4lx2 5jcy
        RB11A_HUMAN | P624911oiv 1oiw 1oix 1yzk 2d7c 2gzd 2gzh 2hv8 4c4p 4d0l 4d0m 4lwz 4lx0 4uj3 4uj4 4uj5 5c46 5c4g 5euq 5ez5 5fbl 5fbq 5fbr 5fbv 5fbw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5JCZ)